LXL04_017872 | RubberDandelionOmics

Gene overview

LXL04_017872

Reference: OH-1004 Chr: Chr04 Coordinates: 2558546-2562054 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2481 bp · LXL04_017872|LXL04_017872|OH1004|cDNA

ATGGCAGCTATTGAAACGCTTCGACCTATAATTCACGGTCAAATCCATGTAAACTCTTCGAATTACAATTCAAAACATTCATACAGGCACACTTCTTTCGTAGATAGATTCCATGTCCTACATAATAAGTCGAATCTTCTTGTAACCAAATCGTCATTATCCATTCGTCCAGCCACCAATTTGTACAGAGAATCTAGGGTTTTCAATTTAAATTCATGGTGTGGAGGGTCAGGGTTTCTGAAGATGAATCAAAACTGTAG...

CDS

Download CDS FASTA

2481 bp · LXL04_017872|LXL04_017872|OH1004|CDS

ATGGCAGCTATTGAAACGCTTCGACCTATAATTCACGGTCAAATCCATGTAAACTCTTCGAATTACAATTCAAAACATTCATACAGGCACACTTCTTTCGTAGATAGATTCCATGTCCTACATAATAAGTCGAATCTTCTTGTAACCAAATCGTCATTATCCATTCGTCCAGCCACCAATTTGTACAGAGAATCTAGGGTTTTCAATTTAAATTCATGGTGTGGAGGGTCAGGGTTTCTGAAGATGAATCAAAACTGTAG...

Protein

Download Protein FASTA

826 aa · LXL04_017872|LXL04_017872|OH1004|PROTEIN

MAAIETLRPIIHGQIHVNSSNYNSKHSYRHTSFVDRFHVLHNKSNLLVTKSSLSIRPATNLYRESRVFNLNSWCGGSGFLKMNQNCRRRNKLGVNNTSCEHDTESSGQKSESDSNKVSKKREKGDKKGKGGGWGWGKGGGKWTWQPIIQAQEIGVLLLQLGIVMFVMRLLRPGLPLPGSEPRVPTAFVSVPYSDFLTKVSTNQVQKVEVDGVHIMFKLKQEQGTPESDITSSLNKMQDSELLLRTVAPTKRIVYTTTRPN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017872`
TK1151 ID	TkA08G044290
OH-1004 ID	LXL04_017872
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 97.023 / OH-1004 86.804 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017872

Location Chr04:2558546-2562054 (-)

Description Similar to FTSH9: ATP-dependent zinc metalloprotease FTSH 9, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g58870`	Probable ATP-dependent zinc metallopeptidase.	No verified direct reference in this release
`At3g47060`	Probable ATP-dependent zinc metallopeptidase.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0649700`	Probable ATP-dependent zinc metallopeptidase.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017872 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0004176 ATP-dependent peptidase activity Molecular Function

GO:0004222 metalloendopeptidase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

amr:AM1_D0237

ath:AT3G47060

ath:AT5G58870

dosa:Os02g0649700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.908

Rank 1 · LXL04_017872 · OH-1004

Mitochondrion0.090

Rank 2 · LXL04_017872 · OH-1004

Nucleus0.034

Rank 3 · LXL04_017872 · OH-1004

Cytoplasm0.022

Rank 4 · LXL04_017872 · OH-1004

Cell membrane0.014

Rank 5 · LXL04_017872 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06480.21FtsH_ext162-246 aa

PF00004.36AAA378-511 aa

PF17862.8AAA_lid_3536-578 aa

PF01434.25Peptidase_M41597-790 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017872	`PF06480.21`	FtsH_ext	162	246	7.6e-06	26.8
LXL04_017872	`PF00004.36`	AAA	378	511	2.4e-44	151.6
LXL04_017872	`PF17862.8`	AAA_lid_3	536	578	1.1e-12	47.9
LXL04_017872	`PF01434.25`	Peptidase_M41	597	790	5.8e-36	124.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FIM2`	Arabidopsis thaliana	ATP-dependent zinc metalloprotease FTSH 9, chloroplastic	71.100%	Swiss-Prot	strong database homology
`Q9SD67`	Arabidopsis thaliana	ATP-dependent zinc metalloprotease FTSH 7, chloroplastic	71.359%	Swiss-Prot	strong database homology
`Q6H6R9`	Oryza sativa subsp. japonica	ATP-dependent zinc metalloprotease FTSH 7, chloroplastic	77.924%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card