LXL04_017720 | RubberDandelionOmics

Gene overview

LXL04_017720

Reference: OH-1004 Chr: Chr04 Coordinates: 326297-330592 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2535 bp · LXL04_017720|LXL04_017720|OH1004|cDNA

ATGAAGGGGGTGGATCTTGAGAGCGTTGAGATCGACCCTATGGACCAaaaatcttttgcaacaaatGTAAAAGATCGAGCATCAAAACGTGTCGACAATGGAGGCAAGCCAGGCGGTTTGTTACCAATGTTGAGCCGCAACTCCAGTAAGGCAAAATCTAACACAAAAAAGGCGCCCACTACTGGTGGGGCCCCTAAGATGGGACGAACAACCTCAAGCGCAGCCAAAGGGCTTAACAGCTTGCGGTTTCTTGATAGGAC...

CDS

Download CDS FASTA

2535 bp · LXL04_017720|LXL04_017720|OH1004|CDS

ATGAAGGGGGTGGATCTTGAGAGCGTTGAGATCGACCCTATGGACCAAAAATCTTTTGCAACAAATGTAAAAGATCGAGCATCAAAACGTGTCGACAATGGAGGCAAGCCAGGCGGTTTGTTACCAATGTTGAGCCGCAACTCCAGTAAGGCAAAATCTAACACAAAAAAGGCGCCCACTACTGGTGGGGCCCCTAAGATGGGACGAACAACCTCAAGCGCAGCCAAAGGGCTTAACAGCTTGCGGTTTCTTGATAGGAC...

Protein

Download Protein FASTA

844 aa · LXL04_017720|LXL04_017720|OH1004|PROTEIN

MKGVDLESVEIDPMDQKSFATNVKDRASKRVDNGGKPGGLLPMLSRNSSKAKSNTKKAPTTGGAPKMGRTTSSAAKGLNSLRFLDRTVTGKEGDAWRAIERRFNQFSVDGKLPRDKFGICVGMGDSIEFAGELYDAMSRRRNIDGEIGLTKDQVRSFWEEMTKKDLDARLSIFFDMCDKNGDGILSEDEVKEVLIMSASANKLSNFKNQAGTYAALIMDELDPDHRGYIEMWQLEILLTGMVSNDQTKPQLTNIKKKNED...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017720`
TK1151 ID	TkA08G054080
OH-1004 ID	LXL04_017720
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 98.820 / OH-1004 39.692 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017720

Location Chr04:326297-330592 (+)

Description Similar to RBOHH: Putative respiratory burst oxidase homolog protein H

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g60010`	Calcium-dependent NADPH oxidase that generates superoxide.	No verified direct reference in this release
`At3g45810`	Calcium-dependent NADPH oxidase that generates superoxide.	No verified direct reference in this release
`At1g64060`	Calcium-dependent NADPH oxidase that generates superoxide.	Arabidopsis gp91phox homologues AtrbohD and AtrbohF are required for accumulation of reactive oxygen intermediates in the plant defense response.2002 · DOI: 10.1073/pnas.012452499 NADPH oxidase AtrbohD and AtrbohF genes function in ROS-dependent ABA signaling in Arabidopsis.2003 · DOI: 10.1093/emboj/cdg277 Extracellular ATP induces the accumulation of superoxide via NADPH oxidases in Arabidopsis.2006 · DOI: 10.1104/pp.105.073072 Ethylene-induced stomatal closure in Arabidopsis occurs via AtrbohF-mediated hydrogen peroxide synthesis.2006 · DOI: 10.1111/j.1365-313x.2006.02842.x
`At5g51060`	Calcium-dependent NADPH oxidase that generates superoxide.	Reactive oxygen species produced by NADPH oxidase regulate plant cell growth.2003 · DOI: 10.1038/nature01485 Hydrogen peroxide mediates plant root cell response to nutrient deprivation.2004 · DOI: 10.1073/pnas.0401707101

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017720 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002679 respiratory burst involved in defense response Biological Process

GO:0006952 defense response Biological Process

GO:0007231 osmosensory signaling pathway Biological Process

GO:0009060 aerobic respiration Biological Process

GO:0009653 anatomical structure morphogenesis Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010053 root epidermal cell differentiation Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0033198 response to ATP Biological Process

GO:0033500 carbohydrate homeostasis Biological Process

KEGG gene cross-reference

ath:AT1G64060

ath:AT3G45810

ath:AT5G51060

ath:AT5G60010

sot:102603596

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.840

Rank 1 · LXL04_017720 · OH-1004

Cytoplasm0.115

Rank 2 · LXL04_017720 · OH-1004

Endoplasmic reticulum0.090

Rank 3 · LXL04_017720 · OH-1004

Nucleus0.036

Rank 4 · LXL04_017720 · OH-1004

Golgi apparatus0.035

Rank 5 · LXL04_017720 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08414.17NADPH_Ox66-168 aa

PF13499.13EF-hand_7172-230 aa

PF01794.26Ferric_reduct345-489 aa

PF08022.19FAD_binding_8531-665 aa

PF08030.18NAD_binding_6671-825 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017720	`PF08414.17`	NADPH_Ox	66	168	9.2e-32	110.1
LXL04_017720	`PF13499.13`	EF-hand_7	172	230	2.7e-06	28.4
LXL04_017720	`PF01794.26`	Ferric_reduct	345	489	7.7e-10	39.6
LXL04_017720	`PF08022.19`	FAD_binding_8	531	665	5.5e-28	97.9
LXL04_017720	`PF08030.18`	NAD_binding_6	671	825	2.5e-44	151.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJD6`	Arabidopsis thaliana	Putative respiratory burst oxidase homolog protein H	57.835%	Swiss-Prot	strong database homology
`Q9LZU9`	Arabidopsis thaliana	Putative respiratory burst oxidase homolog protein J	55.434%	Swiss-Prot	strong database homology
`O48538`	Arabidopsis thaliana	Respiratory burst oxidase homolog protein F	47.958%	Swiss-Prot	moderate database homology
`O81210`	Arabidopsis thaliana	Respiratory burst oxidase homolog protein C	49.377%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card