LXL04_017428 | RubberDandelionOmics

Gene overview

LXL04_017428

Reference: OH-1004 Chr: Chr03 Coordinates: 148765609-148766950 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

768 bp · LXL04_017428|LXL04_017428|OH1004|cDNA

ATGGGCTTTAACCAAGTAAAACAAGAACAAATGATAGAAGAAGTTATATGGGCCGTCTATTTGCAACAATTATTGGGCCGTCTATTTATATGGGCTAATGACGAATGGACTTCAAAAGTTATAGGCAACAAGAAAAGTACAATTTGTCAAGCATTAATCACAATCGATCATCAACACATTGACGCCAAAGATCGTCaaatcgccggaaaaacgaaaCATCGACAATCTCCGCCACGCACCTACCTGAATACAGAAACGGA...

CDS

Download CDS FASTA

768 bp · LXL04_017428|LXL04_017428|OH1004|CDS

ATGGGCTTTAACCAAGTAAAACAAGAACAAATGATAGAAGAAGTTATATGGGCCGTCTATTTGCAACAATTATTGGGCCGTCTATTTATATGGGCTAATGACGAATGGACTTCAAAAGTTATAGGCAACAAGAAAAGTACAATTTGTCAAGCATTAATCACAATCGATCATCAACACATTGACGCCAAAGATCGTCAAATCGCCGGAAAAACGAAACATCGACAATCTCCGCCACGCACCTACCTGAATACAGAAACGGA...

Protein

Download Protein FASTA

255 aa · LXL04_017428|LXL04_017428|OH1004|PROTEIN

MGFNQVKQEQMIEEVIWAVYLQQLLGRLFIWANDEWTSKVIGNKKSTICQALITIDHQHIDAKDRQIAGKTKHRQSPPRTYLNTETEMAREVSESCMDSLLTEIVSSYTNVLYASKPELAARRIEAIGYQVGHQLSERYTMERPRFSDHLEAIKFICKDFWSELFKKQIDNLKTNHRGTFVLQDDKFAWVSRMSSTDNSTSTQEPGNKTSEASSMHLYFPCGIIRGALSNLGISCAVSADISNLPACSFVIRIKV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017428`
TK1151 ID	TkA02G044800
OH-1004 ID	LXL04_017428
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 90.588 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_017428`
Location	Chr03:148765609-148766950 (-)
Description	Similar to TRAPPC6B: Trafficking protein particle complex subunit 6B
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_017428` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process GO:0006901 vesicle coating Biological Process GO:0048208 COPII vesicle coating Biological Process GO:0099022 vesicle tethering Biological Process GO:0005737 cytoplasm Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005801 cis-Golgi network Cellular Component GO:0005802 trans-Golgi network Cellular Component GO:0005829 cytosol Cellular Component GO:0030008 TRAPP complex Cellular Component
KEGG gene cross-reference	bta:521470 dre:450008 hsa:122553 mmu:67091 mmu:78232 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.473

Rank 1 · LXL04_017428 · OH-1004

Nucleus0.323

Rank 2 · LXL04_017428 · OH-1004

Mitochondrion0.113

Rank 3 · LXL04_017428 · OH-1004

Peroxisome0.112

Rank 4 · LXL04_017428 · OH-1004

Golgi apparatus0.054

Rank 5 · LXL04_017428 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04051.22TRAPP98-254 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017428	`PF04051.22`	TRAPP	98	254	5.1e-41	140.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card