LXL04_017380 | RubberDandelionOmics

Gene overview

LXL04_017380

Reference: OH-1004 Chr: Chr03 Coordinates: 147890341-147890847 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

507 bp · LXL04_017380|LXL04_017380|OH1004|cDNA

ATGGCATCTACTCAATGCCTAACATGTACTTGCTaccatcatcttcatcaacataCCAATCTTTCTCACAAACTTCCATCAAACAGTTACAGTATCATCATCAATGCCAAGAAAACCTCCATAATCTCTCAACCCAAtctcagaagaagaagatacAAACTAAAAGCAGTAAAAAGCAGTGGTAGAGAAGATAAGATACAAACCGATGTAGGTGAAGAGATTAAGAAGGAAAGAAGGGTAAGGATTCTGATCGCCGGCGG...

CDS

Download CDS FASTA

507 bp · LXL04_017380|LXL04_017380|OH1004|CDS

ATGGCATCTACTCAATGCCTAACATGTACTTGCTACCATCATCTTCATCAACATACCAATCTTTCTCACAAACTTCCATCAAACAGTTACAGTATCATCATCAATGCCAAGAAAACCTCCATAATCTCTCAACCCAATCTCAGAAGAAGAAGATACAAACTAAAAGCAGTAAAAAGCAGTGGTAGAGAAGATAAGATACAAACCGATGTAGGTGAAGAGATTAAGAAGGAAAGAAGGGTAAGGATTCTGATCGCCGGCGG...

Protein

Download Protein FASTA

168 aa · LXL04_017380|LXL04_017380|OH1004|PROTEIN

MASTQCLTCTCYHHLHQHTNLSHKLPSNSYSIIINAKKTSIISQPNLRRRRYKLKAVKSSGREDKIQTDVGEEIKKERRVRILIAGGGVGGLVLALAAKGRGFDVMVFEKNLSAVRGEGRHRGPIQLMSSALGVLVGIDERVAEQVMEAGCVTGDRLNGLVDGLSGDW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017380`
TK1151 ID	TkA02G045990
OH-1004 ID	LXL04_017380
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017380

Location Chr03:147890341-147890847 (+)

Description Similar to SOVF_077800: Zeaxanthin epoxidase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g67030`	Zeaxanthin epoxidase that plays an important role in the xanthophyll cycle and abscisic acid (ABA) biosynthesis.	Regulation of osmotic stress-responsive gene expression by the LOS6/ABA1 locus in Arabidopsis.2002 · DOI: 10.1074/jbc.m109275200 Hydrotropism in abscisic acid, wavy, and gravitropic mutants of Arabidopsis thaliana.2002 · DOI: 10.1007/s00425-002-0840-3 The effect of zeaxanthin as the only xanthophyll on the structure and function of the photosynthetic apparatus in Arabidopsis thaliana.2004 · DOI: 10.1074/jbc.m311154200 Beta-amino-butyric acid-induced resistance against necrotrophic pathogens is based on ABA-dependent priming for callose.2004 · DOI: 10.1111/j.1365-313x.2004.02028.x Antagonistic interaction between abscisic acid and jasmonate-ethylene signaling pathways modulates defense gene expression and disease resistance in Arabidopsis.2004 · DOI: 10.1105/tpc.104.025833 Dissecting the beta-aminobutyric acid-induced priming phenomenon in Arabidopsis.2005 · DOI: 10.1105/tpc.104.029728 A mutational analysis of the ABA1 gene of Arabidopsis thaliana highlights the involvement of ABA in vegetative development.2005 · DOI: 10.1093/jxb/eri206 The transiently generated nonphotochemical quenching of excitation energy in Arabidopsis leaves is modulated by zeaxanthin.2007 · DOI: 10.1104/pp.106.095562 The ABA1 gene and carotenoid biosynthesis are required for late skotomorphogenic growth in Arabidopsis thaliana.2008 · DOI: 10.1111/j.1365-3040.2007.01759.x New transgenic line of Arabidopsis thaliana with partly disabled zeaxanthin epoxidase activity displays changed carotenoid composition, xanthophyll cycle activity and non-photochemical quenching kinetics.2009 · DOI: 10.1016/j.jplph.2008.12.010 Arabidopsis mutants define a central role for the xanthophyll cycle in the regulation of photosynthetic energy conversion.1998 · DOI: 10.1105/tpc.10.7.1121

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017380 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0009408 response to heat Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009688 abscisic acid biosynthetic process Biological Process

GO:0010114 response to red light Biological Process

GO:0010182 sugar mediated signaling pathway Biological Process

GO:0016123 xanthophyll biosynthetic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT5G67030

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.956

Rank 1 · LXL04_017380 · OH-1004

Mitochondrion0.034

Rank 2 · LXL04_017380 · OH-1004

Nucleus0.034

Rank 3 · LXL04_017380 · OH-1004

Cytoplasm0.012

Rank 4 · LXL04_017380 · OH-1004

Cell membrane0.007

Rank 5 · LXL04_017380 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FGC7`	Arabidopsis thaliana	Zeaxanthin epoxidase, chloroplastic	69.149%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card