LXL04_016998 | RubberDandelionOmics

Gene overview

LXL04_016998

Reference: OH-1004 Chr: Chr03 Coordinates: 138724547-138726013 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1311 bp · LXL04_016998|LXL04_016998|OH1004|cDNA

ATGCACAAACTGATTCGCCTAGCTGCATTATTTACTTTGTCCATTAACAACGAACAAGAAAATTTAGTACAATCTGGTGAAGCATTGGTGAAGCCCATGGATGTGGAATGTTGGAAAAACAAGAGATGGATCTCACTGGTTGACAGTAAAATGAATGCTATATCTGACCAACCAAATTGTCAAACGCTTTCGACTCTGTTTTTTCAGAAAAATCCAAATTTAATAGACATTCCACAAGAATTCTTTAAATATATGCAAGG...

CDS

Download CDS FASTA

1311 bp · LXL04_016998|LXL04_016998|OH1004|CDS

ATGCACAAACTGATTCGCCTAGCTGCATTATTTACTTTGTCCATTAACAACGAACAAGAAAATTTAGTACAATCTGGTGAAGCATTGGTGAAGCCCATGGATGTGGAATGTTGGAAAAACAAGAGATGGATCTCACTGGTTGACAGTAAAATGAATGCTATATCTGACCAACCAAATTGTCAAACGCTTTCGACTCTGTTTTTTCAGAAAAATCCAAATTTAATAGACATTCCACAAGAATTCTTTAAATATATGCAAGG...

Protein

Download Protein FASTA

436 aa · LXL04_016998|LXL04_016998|OH1004|PROTEIN

MHKLIRLAALFTLSINNEQENLVQSGEALVKPMDVECWKNKRWISLVDSKMNAISDQPNCQTLSTLFFQKNPNLIDIPQEFFKYMQGLRVLNLYDTGITSLPQSFLNLVTLKVLCLQECVALVELPLDTIKFQNLEVLDVHGSGLAHIPPQVKNLNCLKRLLISFTRLSSSSHIQEAPNDIEVISKIPMLRELVIDVKEGEAIVLYELIVEVFKLTILSLLQFCFPKKVVNLIQAMGGNWKINFPAEILITEYISKADSL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016998`
TK1151 ID	TkA02G084450
OH-1004 ID	LXL04_016998
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 96.962 / OH-1004 87.844 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016998

Location Chr03:138724547-138726013 (-)

Description Similar to At4g10780: Putative disease resistance protein At4g10780

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g10780`	Potential disease resistance protein.	No verified direct reference in this release
`At4g27190`	Disease resistance protein.	No verified direct reference in this release
`At5g47260`	Potential disease resistance protein.	No verified direct reference in this release
`At1g61180`	Involved in disease resistance via the salicylic acid (SA) signaling pathway.	No verified direct reference in this release
`At1g12210`	Disease resistance (R) protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016998 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009617 response to bacterium Biological Process

GO:0098542 defense response to other organism Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0005525 GTP binding Molecular Function

GO:0043531 ADP binding Molecular Function

KEGG gene cross-reference

ath:AT1G12210

ath:AT1G61180

ath:AT4G10780

ath:AT4G27190

ath:AT5G47260

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.515

Rank 1 · LXL04_016998 · OH-1004

Nucleus0.295

Rank 2 · LXL04_016998 · OH-1004

Cell membrane0.151

Rank 3 · LXL04_016998 · OH-1004

Endoplasmic reticulum0.108

Rank 4 · LXL04_016998 · OH-1004

Extracellular0.069

Rank 5 · LXL04_016998 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23598.2LRR_1446-229 aa

PF13855.13LRR_863-117 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016998	`PF23598.2`	LRR_14	46	229	2.7e-12	46.8
LXL04_016998	`PF13855.13`	LRR_8	63	117	4.3e-08	33.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82484`	Arabidopsis thaliana	Putative disease resistance protein At4g10780	35.616%	Swiss-Prot	weak database homology
`Q9T048`	Arabidopsis thaliana	Disease resistance protein At4g27190	30.808%	Swiss-Prot	weak database homology
`Q9LVT3`	Arabidopsis thaliana	Probable disease resistance protein At5g47260	32.692%	Swiss-Prot	weak database homology
`Q940K0`	Arabidopsis thaliana	Disease resistance protein UNI	31.461%	Swiss-Prot	weak database homology
`Q8L3R3`	Arabidopsis thaliana	Disease resistance protein RFL1	29.586%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card