LXL04_016938 | RubberDandelionOmics

Gene overview

LXL04_016938

Reference: OH-1004 Chr: Chr03 Coordinates: 137289994-137301283 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4388 bp · LXL04_016938|LXL04_016938|OH1004|cDNA

AGGCCCAAATGTTCGTTGCGTAACAGCACTAAGCCACTAATCACGGCGAGTCACTCCGGCGACCCCTTAACTCTCCGACGAGAGCTCTATCACAAACAGACATGGCTCCGAAGAAGAAGCAGCAGCAGCAGCGGAAGTCAGCTTCTTCATCCTCCAAAAGTAAGCCTCAGTCTTCTACGGGTCCCAAACTCCAAATATCGGCAGAGAACGAAAACCGGCTCCGACGGCTTTTACTCAACTCTGGTCGTTCGACGCCTGCT...

CDS

Download CDS FASTA

4287 bp · LXL04_016938|LXL04_016938|OH1004|CDS

ATGGCTCCGAAGAAGAAGCAGCAGCAGCAGCGGAAGTCAGCTTCTTCATCCTCCAAAAGTAAGCCTCAGTCTTCTACGGGTCCCAAACTCCAAATATCGGCAGAGAACGAAAACCGGCTCCGACGGCTTTTACTCAACTCTGGTCGTTCGACGCCTGCTCCGGTTCATGAAGATTCTAGCCTTACCAAAGCGCAGAAGGCCAAAAAATTATACTCCGTTTACGAGAACCTCTCTTGCGAAGGCTTCACTGATGATCAAAT...

Protein

Download Protein FASTA

1428 aa · LXL04_016938|LXL04_016938|OH1004|PROTEIN

MAPKKKQQQQRKSASSSSKSKPQSSTGPKLQISAENENRLRRLLLNSGRSTPAPVHEDSSLTKAQKAKKLYSVYENLSCEGFTDDQIERALSHLKESATFEAALDWLCLSLSPNELPLKFRSSSAVLPDEGGSVSIISTARDDWTPSEDSSVPTETEMPEISIKVKGQKKVDSLDSFQKSQADWIRQYMEQQEEEEYDSWEDAVVDKVSGPRSYDTLREEYHSARLQAIDAKEKGDKKGQQESGQIIRKLKQELADLGIS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016938`
TK1151 ID	TkA02G091360
OH-1004 ID	LXL04_016938
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.500
Protein coverage (%)	TK1151 88.511 / OH-1004 14.566 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016938

Location Chr03:137289994-137301283 (+)

Description Similar to At1g58060: DExH-box ATP-dependent RNA helicase DExH7, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g58060`	DExH-box ATP-dependent RNA helicase DExH7, chloroplastic.	No verified direct reference in this release
`At1g58050`	DExH-box ATP-dependent RNA helicase DExH4, chloroplastic.	No verified direct reference in this release
`At2g35920`	DExH-box ATP-dependent RNA helicase DExH1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016938 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0045727 positive regulation of translation Biological Process

GO:0045948 positive regulation of translational initiation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016282 eukaryotic 43S preinitiation complex Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003724 RNA helicase activity Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0003743 translation initiation factor activity Molecular Function

GO:0004386 helicase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G58050

ath:AT1G58060

ath:AT2G35920

hsa:90957

xla:100049090

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.495

Rank 1 · LXL04_016938 · OH-1004

Cytoplasm0.381

Rank 2 · LXL04_016938 · OH-1004

Cell membrane0.073

Rank 3 · LXL04_016938 · OH-1004

Endoplasmic reticulum0.061

Rank 4 · LXL04_016938 · OH-1004

Golgi apparatus0.055

Rank 5 · LXL04_016938 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24899.2UBA_DHX2969-121 aa

PF24385.2DSRM_DHX29383-475 aa

PF00270.36DEAD593-755 aa

PF00271.38Helicase_C870-1002 aa

PF04408.30WHD_HA21067-1095 aa

PF21010.3HA2_C1099-1167 aa

PF07717.23OB_NTP_bind1258-1356 aa

PF26026.1RNA_hel_CTD1365-1421 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016938	`PF24899.2`	UBA_DHX29	69	121	1.4e-16	60.8
LXL04_016938	`PF24385.2`	DSRM_DHX29	383	475	6.2e-06	27.1
LXL04_016938	`PF00270.36`	DEAD	593	755	2e-10	41.4
LXL04_016938	`PF00271.38`	Helicase_C	870	1002	3.7e-13	50.4
LXL04_016938	`PF04408.30`	WHD_HA2	1067	1095	3.6e-07	30.8
LXL04_016938	`PF21010.3`	HA2_C	1099	1167	2.3e-09	38.4
LXL04_016938	`PF07717.23`	OB_NTP_bind	1258	1356	2.7e-21	76.3
LXL04_016938	`PF26026.1`	RNA_hel_CTD	1365	1421	1.6e-15	57.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I9Q5`	Arabidopsis thaliana	DExH-box ATP-dependent RNA helicase DExH7, chloroplastic	63.705%	Swiss-Prot	strong database homology
`Q9C6G0`	Arabidopsis thaliana	DExH-box ATP-dependent RNA helicase DExH4, chloroplastic	57.598%	Swiss-Prot	strong database homology
`F4ILR7`	Arabidopsis thaliana	DExH-box ATP-dependent RNA helicase DExH1	40.888%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card