LXL04_016436 | RubberDandelionOmics

Gene overview

LXL04_016436

Reference: OH-1004 Chr: Chr03 Coordinates: 123320943-123331647 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2412 bp · LXL04_016436|LXL04_016436|OH1004|cDNA

atGGCCACCAGGCATGATTTCATAGATGAATACAGTACCAGTGATGAAGAAACtcaagaagcagaagaagaagaagatgatgatgatgatgaagttGAACAGGAATCAAAAGATTGCAAAGATATCATCAGAAGCACGTGCCGACCACGTGGGAGAGTGTTCTTGGACCCAAGATCCGAATGGATTCAAGAATGGAACCGTGTCTTCCTTCTGGTGTGCGCCACCGGTCTGTTCATCGACCCGCTGTTCTTCTACACGCT...

CDS

Download CDS FASTA

2412 bp · LXL04_016436|LXL04_016436|OH1004|CDS

ATGGCCACCAGGCATGATTTCATAGATGAATACAGTACCAGTGATGAAGAAACTCAAGAAGCAGAAGAAGAAGAAGATGATGATGATGATGAAGTTGAACAGGAATCAAAAGATTGCAAAGATATCATCAGAAGCACGTGCCGACCACGTGGGAGAGTGTTCTTGGACCCAAGATCCGAATGGATTCAAGAATGGAACCGTGTCTTCCTTCTGGTGTGCGCCACCGGTCTGTTCATCGACCCGCTGTTCTTCTACACGCT...

Protein

Download Protein FASTA

803 aa · LXL04_016436|LXL04_016436|OH1004|PROTEIN

MATRHDFIDEYSTSDEETQEAEEEEDDDDDEVEQESKDCKDIIRSTCRPRGRVFLDPRSEWIQEWNRVFLLVCATGLFIDPLFFYTLSISESCMCVFVDGWFAVTVTVLRCVTDALHVWNMWLQFKMSRWWRSPHHHRGLSHDDDIARNVASRIIKKAKKSFVHGFSDDYSDDYSGDEAVEVDSTESKNSIHGAFRRGVLQAWEQVYLLACITGMFIDPLFFYALSISESWMCVFIDGWLAVTVTVVRCITDALHVANMW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016436`
TK1151 ID	TkA02G142290
OH-1004 ID	LXL04_016436
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	82.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016436

Location Chr03:123320943-123331647 (-)

Description Similar to CNGC4: Cyclic nucleotide-gated ion channel 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54250`	Acts as a cyclic nucleotide-gated ion channel.	HLM1, an essential signaling component in the hypersensitive response, is a member of the cyclic nucleotide-gated channel ion channel family.2003 · DOI: 10.1105/tpc.006999
`At5g15410`	Acts as a cyclic nucleotide-gated ion channel.	The Arabidopsis dnd1 "defense, no death" gene encodes a mutated cyclic nucleotide-gated ion channel.2000 · DOI: 10.1073/pnas.150005697 Developmentally regulated expression of a cyclic nucleotide-gated ion channel from Arabidopsis indicates its involvement in programmed cell death.2001 · DOI: 10.1007/s004250000510
`At5g53130`	Acts as a cyclic nucleotide-gated ion channel.	Expression of a truncated tobacco NtCBP4 channel in transgenic plants and disruption of the homologous Arabidopsis CNGC1 gene confer Pb2+ tolerance.2000 · DOI: 10.1046/j.1365-313x.2000.00901.x Electrophysiological analysis of cloned cyclic nucleotide-gated ion channels.2002 · DOI: 10.1104/pp.010832
`At2g28260`	Putative cyclic nucleotide-gated ion channel.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016436 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007263 nitric oxide mediated signal transduction Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0051592 response to calcium ion Biological Process

GO:0070509 calcium ion import Biological Process

GO:0070588 calcium ion transmembrane transport Biological Process

GO:0071249 cellular response to nitrate Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0005216 monoatomic ion channel activity Molecular Function

KEGG gene cross-reference

ath:AT2G28260

ath:AT5G15410

ath:AT5G54250

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.851

Rank 1 · LXL04_016436 · OH-1004

Cytoplasm0.094

Rank 2 · LXL04_016436 · OH-1004

Endoplasmic reticulum0.064

Rank 3 · LXL04_016436 · OH-1004

Lysosome / Vacuole0.041

Rank 4 · LXL04_016436 · OH-1004

Nucleus0.036

Rank 5 · LXL04_016436 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00027.36cNMP_binding627-714 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016436	`PF00027.36`	cNMP_binding	627	714	2e-07	31.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94AS9`	Arabidopsis thaliana	Cyclic nucleotide-gated ion channel 4	76.066%	Swiss-Prot	strong database homology
`O65718`	Arabidopsis thaliana	Cyclic nucleotide-gated ion channel 2	48.387%	Swiss-Prot	moderate database homology
`O65717`	Arabidopsis thaliana	Cyclic nucleotide-gated ion channel 1	35.322%	Swiss-Prot	moderate database homology
`Q9SL29`	Arabidopsis thaliana	Putative cyclic nucleotide-gated ion channel 15	36.870%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card