LXL04_016198 | RubberDandelionOmics

Gene overview

LXL04_016198

Reference: OH-1004 Chr: Chr03 Coordinates: 114933143-114938582 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4116 bp · LXL04_016198|LXL04_016198|OH1004|cDNA

ATGACATCAAACCAGAGCTTAAGAGATCTTCAATGGCTTCTTCAATCAATTCAAACTGAAAGTCTCGACCTTAAAAGCATCTCCTTCCATCTTTCTCAACCATCATCATGTTGTCATCAAGAAACCCAAGATTCGATTCATATAAACATTTCAAGCGATTCCCATTTCCAGTTTTCCAACATTATAACATCCCTTTCAACATCTCCCAAAACCCAAAATTTGCTGCAAAATCTCGAGTTTTATCAAGTTGAATGGCGGGT...

CDS

Download CDS FASTA

4116 bp · LXL04_016198|LXL04_016198|OH1004|CDS

ATGACATCAAACCAGAGCTTAAGAGATCTTCAATGGCTTCTTCAATCAATTCAAACTGAAAGTCTCGACCTTAAAAGCATCTCCTTCCATCTTTCTCAACCATCATCATGTTGTCATCAAGAAACCCAAGATTCGATTCATATAAACATTTCAAGCGATTCCCATTTCCAGTTTTCCAACATTATAACATCCCTTTCAACATCTCCCAAAACCCAAAATTTGCTGCAAAATCTCGAGTTTTATCAAGTTGAATGGCGGGT...

Protein

Download Protein FASTA

1371 aa · LXL04_016198|LXL04_016198|OH1004|PROTEIN

MTSNQSLRDLQWLLQSIQTESLDLKSISFHLSQPSSCCHQETQDSIHINISSDSHFQFSNIITSLSTSPKTQNLLQNLEFYQVEWRVEEMRGLEVLLDGSINVKQLEFKANRLNAECMKELSKILRKNETIKEVILSESRIGSLGATFIASALKVNSCLEELQIWEDAIGSKGAEELSKMIEANSTLKLLIIFDSSSITATPLISAVLARNRSMEVHLWSGERNKNNSSKVVEFAPESSTLRIYRLSTSGACRVTGALGW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016198`
TK1151 ID	TkA02G175270
OH-1004 ID	LXL04_016198
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016198

Location Chr03:114933143-114938582 (+)

Description Similar to TRN1: Protein TORNADO 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g55540`	Involved in the basipetal transport of auxin (IAA) that modulates growth and organs organization.	LOP1: a gene involved in auxin transport and vascular patterning in Arabidopsis.1996 · DOI: 10.1242/dev.122.6.1811

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016198 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000723 telomere maintenance Biological Process

GO:0007163 establishment or maintenance of cell polarity Biological Process

GO:0007165 signal transduction Biological Process

GO:0007249 canonical NF-kappaB signal transduction Biological Process

GO:0007264 small GTPase-mediated signal transduction Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009825 multidimensional cell growth Biological Process

GO:0009926 auxin polar transport Biological Process

GO:0009933 meristem structural organization Biological Process

GO:0009956 radial pattern formation Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0010305 leaf vascular tissue pattern formation Biological Process

KEGG gene cross-reference

ath:AT5G55540

ddi:DDB_G0291079

hsa:197358

rno:499589

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.437

Rank 1 · LXL04_016198 · OH-1004

Nucleus0.271

Rank 2 · LXL04_016198 · OH-1004

Mitochondrion0.215

Rank 3 · LXL04_016198 · OH-1004

Cell membrane0.179

Rank 4 · LXL04_016198 · OH-1004

Endoplasmic reticulum0.104

Rank 5 · LXL04_016198 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29255.1LRR_NLRC396-213 aa

PF27087.1LRR_TMOD-LMOD97-189 aa

PF29265.1LRR_CARMIL116-203 aa

PF29255.1LRR_NLRC3245-451 aa

PF27087.1LRR_TMOD-LMOD253-328 aa

PF00025.28Arf490-575 aa

PF08477.20Roc494-620 aa

PF16095.12COR-A722-873 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016198	`PF29255.1`	LRR_NLRC3	96	213	1.4e-26	93.9
LXL04_016198	`PF27087.1`	LRR_TMOD-LMOD	97	189	4.7e-21	75.8
LXL04_016198	`PF29265.1`	LRR_CARMIL	116	203	5e-11	42.7
LXL04_016198	`PF29255.1`	LRR_NLRC3	245	451	1.4e-26	93.9
LXL04_016198	`PF27087.1`	LRR_TMOD-LMOD	253	328	4.7e-21	75.8
LXL04_016198	`PF00025.28`	Arf	490	575	3.7e-06	27.3
LXL04_016198	`PF08477.20`	Roc	494	620	1e-05	26.5
LXL04_016198	`PF16095.12`	COR-A	722	873	8.4e-09	36.2
LXL04_016198	`PF25497.2`	COR-B	895	1047	2.7e-13	50.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJ57`	Arabidopsis thaliana	Protein TORNADO 1	64.523%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card