Gene Card
Gene overview
cDNA / CDS / Protein Sequences
453 bp · LXL04_016125|LXL04_016125|OH1004|cDNA
ATGCTTCCTTTATCTCTGCTCAAGACATCACAAGGACATCCTATGCTTGTGGAGCTGAAAAATGGTGAAACTTACAATGGCCATTTAGTGAACTGCGACACTTGGATGAATATCCATCTGCGGGAAGTGATTTGTACTTCAAAAGATGGTGATAGATTCTGGAGGATGCCTGAATGCTACATCCGTGGAAACACCATAAAGTATCTTCGTGTACCAGATGAGGTGATTGACAAGGTTCAAGAAGAAACCAAGAATCGCAC...
453 bp · LXL04_016125|LXL04_016125|OH1004|CDS
ATGCTTCCTTTATCTCTGCTCAAGACATCACAAGGACATCCTATGCTTGTGGAGCTGAAAAATGGTGAAACTTACAATGGCCATTTAGTGAACTGCGACACTTGGATGAATATCCATCTGCGGGAAGTGATTTGTACTTCAAAAGATGGTGATAGATTCTGGAGGATGCCTGAATGCTACATCCGTGGAAACACCATAAAGTATCTTCGTGTACCAGATGAGGTGATTGACAAGGTTCAAGAAGAAACCAAGAATCGCAC...
Protein
Download Protein FASTA150 aa · LXL04_016125|LXL04_016125|OH1004|PROTEIN
MLPLSLLKTSQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECYIRGNTIKYLRVPDEVIDKVQEETKNRTDRKPPGVGRGRGRGGGRDDGGGGGRRQPKGMGRGMDEGGRGRSQGGGYGGNPSGNRGGGRGRG
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_016125 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_016125 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:111345409-111346921 (+) | ||||||||||||
| Description | Similar to Probable U6 snRNA-associated Sm-like protein LSm4 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0000290 deadenylation-dependent decapping of nuclear-transcribed mRNA Biological Process GO:0000387 spliceosomal snRNP assembly Biological Process GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0000956 nuclear-transcribed mRNA catabolic process Biological Process GO:0033962 P-body assembly Biological Process GO:0000932 P-body Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005681 spliceosomal complex Cellular Component GO:0005688 U6 snRNP Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component | ||||||||||||
| KEGG gene cross-reference | ath:AT5G27720 dosa:Os01g0256900 mmu:50783 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01423.29LSM6-70 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_016125 | PF01423.29 | LSM | 6 | 70 | 5.4e-18 | 65.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.