LXL04_016097 | RubberDandelionOmics

Gene overview

LXL04_016097

Reference: OH-1004 Chr: Chr03 Coordinates: 110025752-110029541 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1317 bp · LXL04_016097|LXL04_016097|OH1004|cDNA

ATGAGGACGGTGGAAGATGGGGACTTCATAATCCCTGTATTCGAGAATGTTGAAGACGATGAAGCACCTGTAGAGGAAGAACCTATGGATGAAGAACAGTTGGAGGAAGAAGATGTGGATGAAGTTGAAGTGGGGGGAAATGAAAGTGAGGCCGAGTTTGAGTATAGCACCCATGATCCAAACGTGAAGAACGTCGACTGGTGCACCATGAATCCCATAGCTACTAAGGTTGCTGTCATCGGTGCCGGAATTTCAGGAGC...

CDS

Download CDS FASTA

1317 bp · LXL04_016097|LXL04_016097|OH1004|CDS

ATGAGGACGGTGGAAGATGGGGACTTCATAATCCCTGTATTCGAGAATGTTGAAGACGATGAAGCACCTGTAGAGGAAGAACCTATGGATGAAGAACAGTTGGAGGAAGAAGATGTGGATGAAGTTGAAGTGGGGGGAAATGAAAGTGAGGCCGAGTTTGAGTATAGCACCCATGATCCAAACGTGAAGAACGTCGACTGGTGCACCATGAATCCCATAGCTACTAAGGTTGCTGTCATCGGTGCCGGAATTTCAGGAGC...

Protein

Download Protein FASTA

438 aa · LXL04_016097|LXL04_016097|OH1004|PROTEIN

MRTVEDGDFIIPVFENVEDDEAPVEEEPMDEEQLEEEDVDEVEVGGNESEAEFEYSTHDPNVKNVDWCTMNPIATKVAVIGAGISGAVCASNLAKNGISVTIFESARGPGGRMSRRREIADDDRELYFDHGAPYFTSTNTDVEEMIRRWEARGLVAEWKQNFGSFDFITKKFVNFEKEGLKRKYVGIPGMNSICRALCHEPGIESKFGVMVGRLEWLENEESWTLADVNGQDLGKFNGVVASDKSTFSQRFTKVTGKPPP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016097`
TK1151 ID	TkAUNG092220
OH-1004 ID	LXL04_016097
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 84.247 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_016097`
Location	Chr03:110025752-110029541 (-)
Description	Similar to PSPTO_1126: Renalase (Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_016097` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0050660 flavin adenine dinucleotide binding Molecular Function GO:0050661 NADP binding Molecular Function GO:0050664 oxidoreductase activity, acting on NAD(P)H, oxygen as acceptor Molecular Function GO:0051287 NAD binding Molecular Function GO:0071949 FAD binding Molecular Function
KEGG gene cross-reference	psp:PSPPH_1014 pst:PSPTO_1126 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.500

Rank 1 · LXL04_016097 · OH-1004

Nucleus0.360

Rank 2 · LXL04_016097 · OH-1004

Mitochondrion0.126

Rank 3 · LXL04_016097 · OH-1004

Plastid0.110

Rank 4 · LXL04_016097 · OH-1004

Peroxisome0.068

Rank 5 · LXL04_016097 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01266.31DAO76-114 aa

PF13450.13NAD_binding_879-148 aa

PF01593.31Amino_oxidase84-148 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016097	`PF01266.31`	DAO	76	114	2e-07	31.6
LXL04_016097	`PF13450.13`	NAD_binding_8	79	148	1.1e-15	58.4
LXL04_016097	`PF01593.31`	Amino_oxidase	84	148	5.8e-11	43.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card