LXL04_016006 | RubberDandelionOmics

Gene overview

LXL04_016006

Reference: OH-1004 Chr: Chr03 Coordinates: 103087487-103088679 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

456 bp · LXL04_016006|LXL04_016006|OH1004|cDNA

ATGGCGATTTCCTCCGCCGCACCAACTCTGACCTTACCGTGCACACTATCCATCATAAATCGCACTTCATCATCACCAAAAAGCTTATCCCTCTCTTCTTCCAATTCATTTTTCTTCTCCAACACCCTCAAACCCTTGACCATCGCCTTCGGAAACAGATCCTACGTGCTCAACGGCAAGAAAAAGGGTTTATCCTGTACCTGCTTGTTCGGACTTGGTGTACCGGAGCTAGCGGTTATTGCTGGCGTCGTTGCCCTCgt...

CDS

Download CDS FASTA

456 bp · LXL04_016006|LXL04_016006|OH1004|CDS

ATGGCGATTTCCTCCGCCGCACCAACTCTGACCTTACCGTGCACACTATCCATCATAAATCGCACTTCATCATCACCAAAAAGCTTATCCCTCTCTTCTTCCAATTCATTTTTCTTCTCCAACACCCTCAAACCCTTGACCATCGCCTTCGGAAACAGATCCTACGTGCTCAACGGCAAGAAAAAGGGTTTATCCTGTACCTGCTTGTTCGGACTTGGTGTACCGGAGCTAGCGGTTATTGCTGGCGTCGTTGCCCTCGT...

Protein

Download Protein FASTA

151 aa · LXL04_016006|LXL04_016006|OH1004|PROTEIN

MAISSAAPTLTLPCTLSIINRTSSSPKSLSLSSSNSFFFSNTLKPLTIAFGNRSYVLNGKKKGLSCTCLFGLGVPELAVIAGVVALVFGPKKLPEVGRSIGKTVKSFQQAAKEFETELKKEPESVGESSEVSVVSEKEPEDLKVPTTKDSL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016006`
TK1151 ID	TkA02G278740
OH-1004 ID	LXL04_016006
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016006

Location Chr03:103087487-103088679 (-)

Description Similar to TATA: Sec-independent protein translocase protein TATA, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g28750`	Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across the thylakoid membrane.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0634000`	Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across the thylakoid membrane.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016006 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0032594 protein transport within lipid bilayer Biological Process

GO:0043953 protein transport by the Tat complex Biological Process

GO:0045038 protein import into chloroplast thylakoid membrane Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0016020 membrane Cellular Component

GO:0033281 TAT protein transport complex Cellular Component

GO:0042651 thylakoid membrane Cellular Component

GO:0008320 protein transmembrane transporter activity Molecular Function

GO:0009977 proton motive force dependent protein transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT5G28750

dosa:Os03g0634000

syn:slr1046

zma:541788

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.984

Rank 1 · LXL04_016006 · OH-1004

Mitochondrion0.020

Rank 2 · LXL04_016006 · OH-1004

Nucleus0.016

Rank 3 · LXL04_016006 · OH-1004

Cytoplasm0.011

Rank 4 · LXL04_016006 · OH-1004

Cell membrane0.008

Rank 5 · LXL04_016006 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02416.22TatA_B_E70-117 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016006	`PF02416.22`	TatA_B_E	70	117	5.6e-18	65.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LKU2`	Arabidopsis thaliana	Sec-independent protein translocase protein TATA, chloroplastic	60.909%	Swiss-Prot	strong database homology
`Q75GK3`	Oryza sativa subsp. japonica	Sec-independent protein translocase protein TATA, chloroplastic	63.736%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card