LXL04_015282 | RubberDandelionOmics

Gene overview

LXL04_015282

Reference: OH-1004 Chr: Chr03 Coordinates: 67477283-67490582 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5250 bp · LXL04_015282|LXL04_015282|OH1004|cDNA

ATGGAGGTTGCTAATGAAATAGCGAAAGGAGTTGTTCAGGTTCTCATGGTTCCGGTTAAAAAACAATTGGATTACGTAATTTCCCACAAAAAATATCTGGAGgatatgcacaaaaaaatgaagGATTTGGATGCTAAAAAAGTCGGCGTTGAATCCCAGAAGAAGCAAAACAGAGAAAGACGTCTTGAGGTTCCTGCCCAAGTCAGCCCTTGGTTGGAAGAAGTCGAACAGATGAATGCAAAGGTGGCGGATTTTCCAAG...

CDS

Download CDS FASTA

5250 bp · LXL04_015282|LXL04_015282|OH1004|CDS

ATGGAGGTTGCTAATGAAATAGCGAAAGGAGTTGTTCAGGTTCTCATGGTTCCGGTTAAAAAACAATTGGATTACGTAATTTCCCACAAAAAATATCTGGAGGATATGCACAAAAAAATGAAGGATTTGGATGCTAAAAAAGTCGGCGTTGAATCCCAGAAGAAGCAAAACAGAGAAAGACGTCTTGAGGTTCCTGCCCAAGTCAGCCCTTGGTTGGAAGAAGTCGAACAGATGAATGCAAAGGTGGCGGATTTTCCAAG...

Protein

Download Protein FASTA

1749 aa · LXL04_015282|LXL04_015282|OH1004|PROTEIN

MEVANEIAKGVVQVLMVPVKKQLDYVISHKKYLEDMHKKMKDLDAKKVGVESQKKQNRERRLEVPAQVSPWLEEVEQMNAKVADFPSEVPGCLDLKSRHKLGSKASKIIKEINSVLGRCPEIRGTELQIPLGRIDSTIGSTSTPSSDRSDFRSREHTFTKALEALGPNHSSHMVALWGMGGVGKTTMMKKLKEVVVEKKMFDHYVEAVIGEKTDPIAIQRDVAEYLGIDLTQTSKSARTDKLRTWFVNNSDGGKKKFLVI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015282`
TK1151 ID	TkA02G348840
OH-1004 ID	LXL04_015282
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	81.000
Protein coverage (%)	TK1151 99.592 / OH-1004 99.600 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015282

Location Chr03:67477283-67490582 (-)

Description Similar to At4g27220: Probable disease resistance protein At4g27220

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g27220`	Probable disease resistance protein.	No verified direct reference in this release
`At4g27190`	Disease resistance protein.	No verified direct reference in this release
`At4g26090`	Disease resistance (R) protein that specifically recognizes the AvrRpt2 type III effector avirulence protein from Pseudomonas syringae.	No verified direct reference in this release
`At1g61180`	Involved in disease resistance via the salicylic acid (SA) signaling pathway.	No verified direct reference in this release
`At4g10780`	Potential disease resistance protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015282 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002220 innate immune response activating cell surface receptor signaling pathway Biological Process

GO:0006952 defense response Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0016045 detection of bacterium Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0098542 defense response to other organism Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0043531 ADP binding Molecular Function

KEGG gene cross-reference

ath:AT1G61180

ath:AT4G10780

ath:AT4G26090

ath:AT4G27190

ath:AT4G27220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.597

Rank 1 · LXL04_015282 · OH-1004

Cytoplasm0.249

Rank 2 · LXL04_015282 · OH-1004

Nucleus0.215

Rank 3 · LXL04_015282 · OH-1004

Endoplasmic reticulum0.099

Rank 4 · LXL04_015282 · OH-1004

Extracellular0.042

Rank 5 · LXL04_015282 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00931.29NB-ARC155-323 aa

PF23598.2LRR_14563-647 aa

PF23247.2LRR_RPS2756-874 aa

PF23247.2LRR_RPS2895-1046 aa

PF23247.2LRR_RPS21074-1150 aa

PF23247.2LRR_RPS21146-1243 aa

PF23247.2LRR_RPS21290-1338 aa

PF23247.2LRR_RPS21341-1444 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015282	`PF00931.29`	NB-ARC	155	323	1.7e-24	87.0
LXL04_015282	`PF23598.2`	LRR_14	563	647	8.6e-13	48.5
LXL04_015282	`PF23247.2`	LRR_RPS2	756	874	2.5e-109	363.1
LXL04_015282	`PF23247.2`	LRR_RPS2	895	1046	2.5e-109	363.1
LXL04_015282	`PF23247.2`	LRR_RPS2	1074	1150	2.5e-109	363.1
LXL04_015282	`PF23247.2`	LRR_RPS2	1146	1243	2.5e-109	363.1
LXL04_015282	`PF23247.2`	LRR_RPS2	1290	1338	2.5e-109	363.1
LXL04_015282	`PF23247.2`	LRR_RPS2	1341	1444	2.5e-109	363.1
LXL04_015282	`PF23247.2`	LRR_RPS2	1504	1631	2.5e-109	363.1
LXL04_015282	`PF23247.2`	LRR_RPS2	1621	1705	2.5e-109	363.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81825`	Arabidopsis thaliana	Probable disease resistance protein At4g27220	29.060%	Swiss-Prot	weak database homology
`Q9T048`	Arabidopsis thaliana	Disease resistance protein At4g27190	25.826%	Swiss-Prot	weak database homology
`Q42484`	Arabidopsis thaliana	Disease resistance protein RPS2	26.389%	Swiss-Prot	weak database homology
`Q940K0`	Arabidopsis thaliana	Disease resistance protein UNI	26.568%	Swiss-Prot	weak database homology
`O82484`	Arabidopsis thaliana	Putative disease resistance protein At4g10780	28.043%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card