LXL04_015125 | RubberDandelionOmics

Gene overview

LXL04_015125

Reference: OH-1004 Chr: Chr03 Coordinates: 64307537-64311602 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1722 bp · LXL04_015125|LXL04_015125|OH1004|cDNA

ATGCAACAAGGCGATTACACCTCTACAACTCCGTATTATCACAATTACCCTCAAACCCCTAACCCAAATCCCATCACCGATCTCCACCATCCTCCGGCAACTTACGCCTCCGCACCTCCCTTCACCAACACCACTACTTACCATCCTCCAACCTCCGATTTCTATTCTCCTTACCCTCAACAGCATCCCGATCCTCTCCCTCCTACTGCTCCTTCTTACGCTCCTCCCCCTCCAAACCCTAATCCGCAACCCTCAAGTTT...

CDS

Download CDS FASTA

1722 bp · LXL04_015125|LXL04_015125|OH1004|CDS

ATGCAACAAGGCGATTACACCTCTACAACTCCGTATTATCACAATTACCCTCAAACCCCTAACCCAAATCCCATCACCGATCTCCACCATCCTCCGGCAACTTACGCCTCCGCACCTCCCTTCACCAACACCACTACTTACCATCCTCCAACCTCCGATTTCTATTCTCCTTACCCTCAACAGCATCCCGATCCTCTCCCTCCTACTGCTCCTTCTTACGCTCCTCCCCCTCCAAACCCTAATCCGCAACCCTCAAGTTT...

Protein

Download Protein FASTA

573 aa · LXL04_015125|LXL04_015125|OH1004|PROTEIN

MQQGDYTSTTPYYHNYPQTPNPNPITDLHHPPATYASAPPFTNTTTYHPPTSDFYSPYPQQHPDPLPPTAPSYAPPPPNPNPQPSSFPQFETPHTPYQSQPPYNSPYDHHQTPPTYPSPPASSIPHNSTPLNHSSSFQYSSSLYTNPSPVPSQVPGPAYESPYETGYGGNYGRSTSDLGGGGGSADYYGKRPDVGMSRFEPSGGYGGDGYGEGVYAYQGGKAEPYGSRGTASKSSTWKEKVIFDDFGRPIGLPGKDSPSI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015125`
TK1151 ID	TkA02G365120
OH-1004 ID	LXL04_015125
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015125

Location Chr03:64307537-64311602 (+)

Description Similar to FREE1: Protein FREE1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g20110`	Endosomal sorting complex required for transport (ESCRT) component regulating multivesicular body (MVB) protein sorting and plant growth.	A unique plant ESCRT component, FREE1, regulates multivesicular body protein sorting and plant growth.2014 · DOI: 10.1016/j.cub.2014.09.014 Dual roles of an Arabidopsis ESCRT component FREE1 in regulating vacuolar protein transport and autophagic degradation.2015 · DOI: 10.1073/pnas.1421271112 FYVE1 is essential for vacuole biogenesis and intracellular trafficking in Arabidopsis.2015 · DOI: 10.1104/pp.114.253377 FYVE1/FREE1 Interacts with the PYL4 ABA Receptor and Mediates Its Delivery to the Vacuolar Degradation Pathway.2016 · DOI: 10.1105/tpc.16.00178 The effect of ABRE BINDING FACTOR 4-mediated FYVE1 on salt stress tolerance in Arabidopsis.2020 · DOI: 10.1016/j.plantsci.2020.110489

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015125 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006897 endocytosis Biological Process

GO:0007264 small GTPase-mediated signal transduction Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0015031 protein transport Biological Process

GO:0030100 regulation of endocytosis Biological Process

GO:0034058 endosomal vesicle fusion Biological Process

GO:0034498 early endosome to Golgi transport Biological Process

GO:0035973 aggrephagy Biological Process

GO:0036258 multivesicular body assembly Biological Process

GO:0042059 negative regulation of epidermal growth factor receptor signaling pathway Biological Process

GO:0060586 multicellular organismal-level iron ion homeostasis Biological Process

KEGG gene cross-reference

ath:AT1G20110

cel:CELE_R160.7

hsa:23001

mmu:216724

mmu:72145

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.475

Rank 1 · LXL04_015125 · OH-1004

Cell membrane0.304

Rank 2 · LXL04_015125 · OH-1004

Nucleus0.262

Rank 3 · LXL04_015125 · OH-1004

Golgi apparatus0.097

Rank 4 · LXL04_015125 · OH-1004

Endoplasmic reticulum0.093

Rank 5 · LXL04_015125 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01363.28FYVE420-483 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015125	`PF01363.28`	FYVE	420	483	7.9e-20	71.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ASS2`	Arabidopsis thaliana	Protein FREE1	57.619%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card