LXL04_014644 | RubberDandelionOmics

Gene overview

LXL04_014644

Reference: OH-1004 Chr: Chr03 Coordinates: 54305406-54306782 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1377 bp · LXL04_014644|LXL04_014644|OH1004|cDNA

ATGGCTTCATTACTGCTCTCATTCTCCTCCCTTCTATTCACCATATTTTGTCTGCAACTGCTCTTCAATTCCCCGACCCTTTCCACCTCCAGACGTGTCCTCCACGATCATGTCCACGAAAACCTCGAAACCGGGTTTAGGGTGGCCCTCACACATGTCGATGCCGGGAAAAACTTGACGAAGTTTGAGCGTCTACAGCTCGGCGTAAAGAGAGGTAACCTCCGGTTAGAAAGGCTCATTAGTAACATGATGGCGAGTCT...

CDS

Download CDS FASTA

1377 bp · LXL04_014644|LXL04_014644|OH1004|CDS

ATGGCTTCATTACTGCTCTCATTCTCCTCCCTTCTATTCACCATATTTTGTCTGCAACTGCTCTTCAATTCCCCGACCCTTTCCACCTCCAGACGTGTCCTCCACGATCATGTCCACGAAAACCTCGAAACCGGGTTTAGGGTGGCCCTCACACATGTCGATGCCGGGAAAAACTTGACGAAGTTTGAGCGTCTACAGCTCGGCGTAAAGAGAGGTAACCTCCGGTTAGAAAGGCTCATTAGTAACATGATGGCGAGTCT...

Protein

Download Protein FASTA

458 aa · LXL04_014644|LXL04_014644|OH1004|PROTEIN

MASLLLSFSSLLFTIFCLQLLFNSPTLSTSRRVLHDHVHENLETGFRVALTHVDAGKNLTKFERLQLGVKRGNLRLERLISNMMASLSVDSSSQLTSPVHAGNGEFLMNLAIGTPPEKFSAIMDTGSDLIWTQCKPCTKCFDAPTPIFDPKKSSSFSKVPCSNSLCKALPTSDCGSDGCEYLYSYGDYSSTQGILATETFMFDKVSVPSLGFGCGEDNEGSGFNQGGGLVGLGRGPLSLVSQLKKSTFSYCLTSMNDDTS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014644`
TK1151 ID	TkA02G406800
OH-1004 ID	LXL04_014644
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	96.900
Protein coverage (%)	TK1151 100.000 / OH-1004 76.638 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014644

Location Chr03:54305406-54306782 (-)

Description Similar to nep1: Aspartic proteinase nepenthesin-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g01300`	Aspartyl protease.	No verified direct reference in this release
`At3g20015`	Aspartic protease that may be involved in drought avoidance through abscisic acid signaling.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0448500`	Anther-specific aspartic protease involved in tapetal programmed cell death (PCD).	EAT1 promotes tapetal cell death by regulating aspartic proteases during male reproductive development in rice.2013 · DOI: 10.1038/ncomms2396

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014644 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0043067 regulation of programmed cell death Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0004190 aspartic-type endopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G01300

ath:AT3G20015

dosa:Os04g0448500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.486

Rank 1 · LXL04_014644 · OH-1004

Cell membrane0.147

Rank 2 · LXL04_014644 · OH-1004

Endoplasmic reticulum0.124

Rank 3 · LXL04_014644 · OH-1004

Lysosome / Vacuole0.113

Rank 4 · LXL04_014644 · OH-1004

Cytoplasm0.087

Rank 5 · LXL04_014644 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14543.12TAXi_N106-261 aa

PF00026.29Asp106-450 aa

PF14541.12TAXi_C298-450 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014644	`PF14543.12`	TAXi_N	106	261	4.3e-48	164.5
LXL04_014644	`PF00026.29`	Asp	106	450	2.2e-21	77.4
LXL04_014644	`PF14541.12`	TAXi_C	298	450	5.9e-33	114.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LNJ3`	Arabidopsis thaliana	Aspartyl protease family protein 2	36.792%	Swiss-Prot	moderate database homology
`Q9LHE3`	Arabidopsis thaliana	Protein ASPARTIC PROTEASE IN GUARD CELL 2	33.716%	Swiss-Prot	moderate database homology
`Q7XV21`	Oryza sativa subsp. japonica	Aspartyl protease 37	33.257%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card