LXL04_014481 | RubberDandelionOmics

Gene overview

LXL04_014481

Reference: OH-1004 Chr: Chr03 Coordinates: 50155062-50156472 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

891 bp · LXL04_014481|LXL04_014481|OH1004|cDNA

AGGCGGCGGGGGACGGAGGAGATGGACTTTAACTCGGGTGGCGGCGGAGGTGCAGGAAGCGGAGGTAATGACGTGGAGCTGTTGTCCAAGACGTTGCAGGTGGAGCACAAACTGTTTTACTTTGATCTCAAGGAGAATCCGCGCGGTCGTTACCTGAAGATATCGGAGAAAACGTCGGCGACAAGGTCCACCATAATCGTACCTTTCAACGGAATCTCATGGTTCTTCGACATCTTCAACTACTACGTCACTTCCGATGA...

CDS

Download CDS FASTA

870 bp · LXL04_014481|LXL04_014481|OH1004|CDS

ATGGACTTTAACTCGGGTGGCGGCGGAGGTGCAGGAAGCGGAGGTAATGACGTGGAGCTGTTGTCCAAGACGTTGCAGGTGGAGCACAAACTGTTTTACTTTGATCTCAAGGAGAATCCGCGCGGTCGTTACCTGAAGATATCGGAGAAAACGTCGGCGACAAGGTCCACCATAATCGTACCTTTCAACGGAATCTCATGGTTCTTCGACATCTTCAACTACTACGTCACTTCCGATGACCAAGATATTTCTAGCAAGGA...

Protein

Download Protein FASTA

289 aa · LXL04_014481|LXL04_014481|OH1004|PROTEIN

MDFNSGGGGGAGSGGNDVELLSKTLQVEHKLFYFDLKENPRGRYLKISEKTSATRSTIIVPFNGISWFFDIFNYYVTSDDQDISSKELQLDSKVFYFDIGENRRGRFLKVSEASVSRNRSTIIVPAGSTRDEGWSAFRNILEEINEASKLFVLPNQQNSDSITPERLVGLSDDVGAGFIAGNSSQPAPPPSTESTFELPPPSSDESGGFGVSKVIRADQKRFFFDLGSNNRGHYLRISEVAGSDRSSIILPLSGLKQFHE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014481`
TK1151 ID	TkAUNG000890
OH-1004 ID	LXL04_014481
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.700
Protein coverage (%)	TK1151 97.635 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014481

Location Chr03:50155062-50156472 (+)

Description Similar to PURA1: Transcription factor Pur-alpha 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g32080`	Transcription factor that specifically binds the purine-rich double-stranded telomeric repeated sequence 5'-AAACCCTAA-3' found in promoter telo boxes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014481 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006270 DNA replication initiation Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0007281 germ cell development Biological Process

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0040012 regulation of locomotion Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0050673 epithelial cell proliferation Biological Process

GO:0000781 chromosome, telomeric region Cellular Component

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT2G32080

cel:CELE_F45E4.2

dre:393519

hsa:5813

mmu:19290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.911

Rank 1 · LXL04_014481 · OH-1004

Cytoplasm0.253

Rank 2 · LXL04_014481 · OH-1004

Cell membrane0.031

Rank 3 · LXL04_014481 · OH-1004

Endoplasmic reticulum0.022

Rank 4 · LXL04_014481 · OH-1004

Lysosome / Vacuole0.019

Rank 5 · LXL04_014481 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04845.20PurA19-146 aa

PF04845.20PurA212-265 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014481	`PF04845.20`	PurA	19	146	6.5e-36	124.5
LXL04_014481	`PF04845.20`	PurA	212	265	6.5e-36	124.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SKZ1`	Arabidopsis thaliana	Transcription factor Pur-alpha 1	78.261%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card