LXL04_013960 | RubberDandelionOmics

Gene overview

LXL04_013960

Reference: OH-1004 Chr: Chr03 Coordinates: 39138512-39143365 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1719 bp · LXL04_013960|LXL04_013960|OH1004|cDNA

ATGTCAACCTTGATGCATGATTGTTTGGATGCACCTTCACGATCAGGAAACCTGCTGACAAACAATGCTCGTAGGTGTCAGAGGTTTGTTGAGGAGGGGCTTATATGTAAAAATGGTGAAAGTTGCAAAACAATCGGGATTTTAAAGCTTCGGTATCCCGCCCACCTCGTCACCTTCGTGACCTCCagaaccctagcgccgcgaTGCTGCCTTCCTTGCGAGCTCCGACGGAAATTAGCTGCAGACCCGGCGAGCTCTCC...

CDS

Download CDS FASTA

1719 bp · LXL04_013960|LXL04_013960|OH1004|CDS

ATGTCAACCTTGATGCATGATTGTTTGGATGCACCTTCACGATCAGGAAACCTGCTGACAAACAATGCTCGTAGGTGTCAGAGGTTTGTTGAGGAGGGGCTTATATGTAAAAATGGTGAAAGTTGCAAAACAATCGGGATTTTAAAGCTTCGGTATCCCGCCCACCTCGTCACCTTCGTGACCTCCAGAACCCTAGCGCCGCGATGCTGCCTTCCTTGCGAGCTCCGACGGAAATTAGCTGCAGACCCGGCGAGCTCTCC...

Protein

Download Protein FASTA

572 aa · LXL04_013960|LXL04_013960|OH1004|PROTEIN

MSTLMHDCLDAPSRSGNLLTNNARRCQRFVEEGLICKNGESCKTIGILKLRYPAHLVTFVTSRTLAPRCCLPCELRRKLAADPASSPAATAFISLHLRRAVIARAVTGIPGRTDDSGVSTPRNPAIISGANPYSDESPAPPFLRLARPHSFPHLVVWLPRRPPQAAFLLLVSGVPIKPSSVSHGLNPHLTRIDPLAQPRSAPFLRHHHTSARVLSFPDGAIPHACSPSSMARSSNFPLHIYPPVEAVENEDPQQTLHLGR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013960`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013960

Location Chr03:39138512-39143365 (-)

Description Similar to ARASP: Membrane metalloprotease ARASP, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g32480`	Metalloprotease essential for chloroplast and plant development.	No verified direct reference in this release
`At1g05140`	Metalloprotease essential for chloroplast and plant development.	No verified direct reference in this release
`At1g21170`	Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane during regulated or polarized secretion.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013960 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0006887 exocytosis Biological Process

GO:0006893 Golgi to plasma membrane transport Biological Process

GO:0009409 response to cold Biological Process

GO:0009644 response to high light intensity Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0060321 acceptance of pollen Biological Process

GO:0000145 exocyst Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

KEGG gene cross-reference

ana:all3971

ath:AT1G05140

ath:AT1G21170

ath:AT2G32480

syn:slr1821

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.396

Rank 1 · LXL04_013960 · OH-1004

Cytoplasm0.341

Rank 2 · LXL04_013960 · OH-1004

Cell membrane0.132

Rank 3 · LXL04_013960 · OH-1004

Mitochondrion0.110

Rank 4 · LXL04_013960 · OH-1004

Plastid0.093

Rank 5 · LXL04_013960 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80885`	Arabidopsis thaliana	Membrane metalloprotease ARASP, chloroplastic	65.217%	Swiss-Prot	weak database homology
`O23053`	Arabidopsis thaliana	Probable membrane metalloprotease ARASP2, chloroplastic	49.102%	Swiss-Prot	weak database homology
`F4HWE6`	Arabidopsis thaliana	Exocyst complex component SEC5B	61.111%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card