Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3033 bp · LXL04_013599|LXL04_013599|OH1004|cDNA
ATGGCTTCGACGGTGGCTCAACGAGCTGAACTCGCCAAGTTTTGTAGTTCTCGTGACTGGTCTAAAGCTATTCGCGTTCTCGATTCTCTCCTCTCTCAATCATGCGTTATTCAGGATATTTGTAATCGTGCGTACTGTTATAGTCAATTGGAGCTTCACAAACATGTGATTAAGGACTGTGACAAGGCTCTTCAGCTCGATCCTACGCTTCTTCAAGCCTATATCCTCAAAGGCCATGCGTATTCTGCATTGGGAAGAAA...
3033 bp · LXL04_013599|LXL04_013599|OH1004|CDS
ATGGCTTCGACGGTGGCTCAACGAGCTGAACTCGCCAAGTTTTGTAGTTCTCGTGACTGGTCTAAAGCTATTCGCGTTCTCGATTCTCTCCTCTCTCAATCATGCGTTATTCAGGATATTTGTAATCGTGCGTACTGTTATAGTCAATTGGAGCTTCACAAACATGTGATTAAGGACTGTGACAAGGCTCTTCAGCTCGATCCTACGCTTCTTCAAGCCTATATCCTCAAAGGCCATGCGTATTCTGCATTGGGAAGAAA...
Protein
Download Protein FASTA1010 aa · LXL04_013599|LXL04_013599|OH1004|PROTEIN
MASTVAQRAELAKFCSSRDWSKAIRVLDSLLSQSCVIQDICNRAYCYSQLELHKHVIKDCDKALQLDPTLLQAYILKGHAYSALGRKDDAVMVWEQGYEHAVHLSVDLKQVLELEELLTAAKQSMAEAKQLSEWSVSKPEPTNSVIKSSETFNNHTMSNLGYGPCGDSKEIESKQNDSSSNGNQQNGTHNISVDFGARSSSSSDNRNKSDLSTKISLVPSKSSDKSDMDSEQSNKGNKKFSVTRISKAKSINVDFRLSRG...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_013599 |
|---|---|
| TK1151 ID | TkAUNG091870 |
| OH-1004 ID | LXL04_013599 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 87.400 |
| Protein coverage (%) | TK1151 93.539 / OH-1004 67.030Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_013599 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:32262545-32267619 (-) | |||||||||
| Description | Similar to SRFR1: Suppressor of RPS4-RLD 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006493 protein O-linked glycosylation Biological Process GO:0009910 negative regulation of flower development Biological Process GO:0010228 vegetative to reproductive phase transition of meristem Biological Process GO:0031348 negative regulation of defense response Biological Process GO:0042742 defense response to bacterium Biological Process GO:0045892 negative regulation of DNA-templated transcription Biological Process GO:0046813 receptor-mediated virion attachment to host cell Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0016020 membrane Cellular Component GO:0048471 perinuclear region of cytoplasm Cellular Component GO:0016757 glycosyltransferase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT3G04240 ath:AT4G37460 hsa:79573 syn:slr0751 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00515.35TPR_141-69 aaPF29407.1CFAP70_TPR_C238-347 aaPF13432.13TPR_16259-314 aaPF14559.13TPR_19266-308 aaPF00515.35TPR_1287-319 aaPF13432.13TPR_16293-352 aaPF00515.35TPR_1322-353 aaPF00515.35TPR_1402-433 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_013599 | PF00515.35 | TPR_1 | 41 | 69 | 1.8e-50 | 167.5 |
| LXL04_013599 | PF29407.1 | CFAP70_TPR_C | 238 | 347 | 7.3e-14 | 52.6 |
| LXL04_013599 | PF13432.13 | TPR_16 | 259 | 314 | 3.3e-15 | 56.9 |
| LXL04_013599 | PF14559.13 | TPR_19 | 266 | 308 | 2.2e-21 | 76.6 |
| LXL04_013599 | PF00515.35 | TPR_1 | 287 | 319 | 1.8e-50 | 167.5 |
| LXL04_013599 | PF13432.13 | TPR_16 | 293 | 352 | 3.3e-15 | 56.9 |
| LXL04_013599 | PF00515.35 | TPR_1 | 322 | 353 | 1.8e-50 | 167.5 |
| LXL04_013599 | PF00515.35 | TPR_1 | 402 | 433 | 1.8e-50 | 167.5 |
| LXL04_013599 | PF00515.35 | TPR_1 | 434 | 464 | 1.8e-50 | 167.5 |
| LXL04_013599 | PF00515.35 | TPR_1 | 503 | 531 | 1.8e-50 | 167.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.