LXL04_013337 | RubberDandelionOmics

Gene overview

LXL04_013337

Reference: OH-1004 Chr: Chr03 Coordinates: 28080387-28081258 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

423 bp · LXL04_013337|LXL04_013337|OH1004|cDNA

ATGGGATCGGTGGCGTCAGCGTTGATGGGAGGTGGAGAACAGAATGCCCCCGACGGCGACTCATCATCGGAGGAATCACGAGTAATTGAGTTTCATTCTTCTAACCGCTGGCAGCTCCATTACAATCAGGCGAAACAATCCCCCAAACTGATGGTGGTGGATTTCTCGGCCACATGGTGTGGACCCTGCAAGATGCTAGAGCCGTTTATCCGCTCTCTCGCTTCCAAATATCAAGAAATCGACTTCATCAAGATCGATGT...

CDS

Download CDS FASTA

423 bp · LXL04_013337|LXL04_013337|OH1004|CDS

ATGGGATCGGTGGCGTCAGCGTTGATGGGAGGTGGAGAACAGAATGCCCCCGACGGCGACTCATCATCGGAGGAATCACGAGTAATTGAGTTTCATTCTTCTAACCGCTGGCAGCTCCATTACAATCAGGCGAAACAATCCCCCAAACTGATGGTGGTGGATTTCTCGGCCACATGGTGTGGACCCTGCAAGATGCTAGAGCCGTTTATCCGCTCTCTCGCTTCCAAATATCAAGAAATCGACTTCATCAAGATCGATGT...

Protein

Download Protein FASTA

140 aa · LXL04_013337|LXL04_013337|OH1004|PROTEIN

MGSVASALMGGGEQNAPDGDSSSEESRVIEFHSSNRWQLHYNQAKQSPKLMVVDFSATWCGPCKMLEPFIRSLASKYQEIDFIKIDVDELKDVAQQFEVQAMPTIVLLKQGKEIGRVVGAKKDELEKKILQNRVAPKFAA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013337`
TK1151 ID	TkA03G594350
OH-1004 ID	LXL04_013337
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	55.000
Protein coverage (%)	TK1151 71.613 / OH-1004 79.286 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013337

Location Chr03:28080387-28081258 (+)

Description Similar to TRX2: Thioredoxin H2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g39950`	Thiol-disulfide oxidoreductase probably involved in the redox regulation of a number of cytosolic enzymes.	No verified direct reference in this release
`At1g59730`	Probable thiol-disulfide oxidoreductase that may be involved in the redox regulation of a number of cytosolic enzymes.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0800700`	Probable thiol-disulfide oxidoreductase that may be involved in the redox regulation of a number of cytosolic enzymes.	No verified direct reference in this release
`Os07g0190800`	Probable thiol-disulfide oxidoreductase that may be involved in the redox regulation of a number of cytosolic enzymes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013337 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0015035 protein-disulfide reductase activity Molecular Function

GO:0016671 oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor Molecular Function

GO:0016712 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen Molecular Function

KEGG gene cross-reference

ath:AT1G59730

ath:AT5G39950

dosa:Os03g0800700

dosa:Os07g0190800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.460

Rank 1 · LXL04_013337 · OH-1004

Nucleus0.251

Rank 2 · LXL04_013337 · OH-1004

Endoplasmic reticulum0.220

Rank 3 · LXL04_013337 · OH-1004

Mitochondrion0.171

Rank 4 · LXL04_013337 · OH-1004

Cell membrane0.150

Rank 5 · LXL04_013337 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04756.20OST3_OST624-112 aa

PF13098.14Thioredoxin_242-128 aa

PF00085.27Thioredoxin43-129 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013337	`PF04756.20`	OST3_OST6	24	112	4.8e-06	26.9
LXL04_013337	`PF13098.14`	Thioredoxin_2	42	128	8.7e-12	46.1
LXL04_013337	`PF00085.27`	Thioredoxin	43	129	2.9e-29	101.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38879`	Arabidopsis thaliana	Thioredoxin H2	58.647%	Swiss-Prot	strong database homology
`Q9XIF4`	Arabidopsis thaliana	Thioredoxin H7	47.287%	Swiss-Prot	moderate database homology
`Q851R5`	Oryza sativa subsp. japonica	Thioredoxin H2-2	48.462%	Swiss-Prot	moderate database homology
`Q6Z4I3`	Oryza sativa subsp. japonica	Thioredoxin H2-1	46.774%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card