LXL04_013278 | RubberDandelionOmics

Gene overview

LXL04_013278

Reference: OH-1004 Chr: Chr03 Coordinates: 26934158-26935677 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

774 bp · LXL04_013278|LXL04_013278|OH1004|cDNA

ATGGCCTGCGCGAATTGGTTACACTCGTCTGCCCTCTTTCATGCTAGCTTCTCTACTACTAGCCTTCGGCGGGATACCCTTTCGTCAAGCTTCCGGCCAGCCACTTCCTCCGACGGCCGGTCAATATTCTCATCGAGTTACCAATACAGACCTCCAGCCATCGCCGTCCAAGCTCAGGCCAAGCGAGGGTTCTCGCTGAAAAAGGAAGAGGAAACAGCTTCAGCTGCCGATATGCACTTCGAAGCTCCGCTCAAAATTGT...

CDS

Download CDS FASTA

774 bp · LXL04_013278|LXL04_013278|OH1004|CDS

ATGGCCTGCGCGAATTGGTTACACTCGTCTGCCCTCTTTCATGCTAGCTTCTCTACTACTAGCCTTCGGCGGGATACCCTTTCGTCAAGCTTCCGGCCAGCCACTTCCTCCGACGGCCGGTCAATATTCTCATCGAGTTACCAATACAGACCTCCAGCCATCGCCGTCCAAGCTCAGGCCAAGCGAGGGTTCTCGCTGAAAAAGGAAGAGGAAACAGCTTCAGCTGCCGATATGCACTTCGAAGCTCCGCTCAAAATTGT...

Protein

Download Protein FASTA

257 aa · LXL04_013278|LXL04_013278|OH1004|PROTEIN

MACANWLHSSALFHASFSTTSLRRDTLSSSFRPATSSDGRSIFSSSYQYRPPAIAVQAQAKRGFSLKKEEETASAADMHFEAPLKIVLYPDPILRAKNKLVDTFDDNLKKLVDEMFDVMYKTDGIGLSAPQVGINIQVMVFNPVGERGEGEEIVLVNPRVTRYSKKLAPFTEGCLSFPGINADVVRPEAVKVDAQDITGEKFSGVLFFDRMSAEIVDSIRTQLQELEQKYEDRTGLASPEKIETRKRWKAAAGFGRS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013278`
TK1151 ID	TkA02G508300
OH-1004 ID	LXL04_013278
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013278

Location Chr03:26934158-26935677 (-)

Description Similar to PDF1B: Peptide deformylase 1B, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g14660`	Removes the formyl group from the N-terminal Met of newly synthesized proteins.	Eukaryotic peptide deformylases. Nuclear-encoded and chloroplast-targeted enzymes in Arabidopsis.2001 · DOI: 10.1104/pp.127.1.97 Insights into the substrate specificity of plant peptide deformylase, an essential enzyme with potential for the development of novel biotechnology applications in agriculture.2008 · DOI: 10.1042/bj20071641

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0637600`	Removes the formyl group from the N-terminal Met of newly synthesized proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013278 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006412 translation Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0042586 peptide deformylase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT5G14660

dosa:Os01g0637600

rba:RB12856

sly:543648

syp:SYNPCC7002_A2348

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.966

Rank 1 · LXL04_013278 · OH-1004

Nucleus0.037

Rank 2 · LXL04_013278 · OH-1004

Mitochondrion0.033

Rank 3 · LXL04_013278 · OH-1004

Cytoplasm0.021

Rank 4 · LXL04_013278 · OH-1004

Cell membrane0.014

Rank 5 · LXL04_013278 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01327.27Pep_deformylase84-203 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013278	`PF01327.27`	Pep_deformylase	84	203	1.1e-36	126.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FUZ2`	Arabidopsis thaliana	Peptide deformylase 1B, chloroplastic/mitochondrial	53.650%	Swiss-Prot	strong database homology
`Q5VNN5`	Oryza sativa subsp. japonica	Peptide deformylase 1B, chloroplastic	59.135%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card