Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1782 bp · LXL04_012250|LXL04_012250|OH1004|cDNA
ATGGCGGATAAGAGGAAGATCAAGACCGAAGCTAGCAGTAGCAGCAGTAACACCAATAATGGTAGAGGCGAAAGCGTCGTCGTCGATGTTGGTCGCCGGAGAAGCTCTTGCGGTTATTGCAAATCCGGCTCCAACACCAGTATTACTCACGGTTTATGGGCACACAGTTTGACTGTTCATGACTACCAAGCTCTTCTTGACAGAGGCTGGAGAAGATCCGGCTGTTTTCTCTACAAACCAGAAATGGAAAAGACATGTTG...
1782 bp · LXL04_012250|LXL04_012250|OH1004|CDS
ATGGCGGATAAGAGGAAGATCAAGACCGAAGCTAGCAGTAGCAGCAGTAACACCAATAATGGTAGAGGCGAAAGCGTCGTCGTCGATGTTGGTCGCCGGAGAAGCTCTTGCGGTTATTGCAAATCCGGCTCCAACACCAGTATTACTCACGGTTTATGGGCACACAGTTTGACTGTTCATGACTACCAAGCTCTTCTTGACAGAGGCTGGAGAAGATCCGGCTGTTTTCTCTACAAACCAGAAATGGAAAAGACATGTTG...
Protein
Download Protein FASTA593 aa · LXL04_012250|LXL04_012250|OH1004|PROTEIN
MADKRKIKTEASSSSSNTNNGRGESVVVDVGRRRSSCGYCKSGSNTSITHGLWAHSLTVHDYQALLDRGWRRSGCFLYKPEMEKTCCPSYTIRLKASDFIPSKEQTRVSKRMQKFLEGSLTSKKPEEQISPSTESHSINISQENKIENYLSNEINSIVIACTQRGEFPNDVNTPKASVKPVAPSKRKVQAEEAHDLLYTSNISFQISASLKRANKTLQKNNQSMDPNPKLISEILSGYFSNLPPTLKLSVKPCNGHINFY...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_012250 |
|---|---|
| TK1151 ID | TkA02G578560 |
| OH-1004 ID | LXL04_012250 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 98.300 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_012250 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:9072265-9074878 (-) | |||||||||
| Description | Similar to ATE2: Arginyl-tRNA--protein transferase 2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0006979 response to oxidative stress Biological Process GO:0009737 response to abscisic acid Biological Process GO:0010029 regulation of seed germination Biological Process GO:0010150 leaf senescence Biological Process GO:0010498 proteasomal protein catabolic process Biological Process GO:0016598 protein arginylation Biological Process GO:0044314 protein K27-linked ubiquitination Biological Process GO:0050832 defense response to fungus Biological Process GO:0050994 regulation of lipid catabolic process Biological Process GO:0070534 protein K63-linked ubiquitination Biological Process GO:0071211 protein targeting to vacuole involved in autophagy Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT3G11240 ath:AT5G05700 hsa:11101 mmu:11907 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04376.20ATE_N35-107 aaPF04377.22ATE_C305-447 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_012250 | PF04376.20 | ATE_N | 35 | 107 | 1.7e-24 | 86.5 |
| LXL04_012250 | PF04377.22 | ATE_C | 305 | 447 | 5.8e-46 | 156.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.