LXL04_012205 | RubberDandelionOmics

Gene overview

LXL04_012205

Reference: OH-1004 Chr: Chr03 Coordinates: 8264295-8264906 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

612 bp · LXL04_012205|LXL04_012205|OH1004|cDNA

ATGGCAAACAATcagttcatcatcatcatcaccaccATCCTCCTCTCCCTAGCCTTCCACAGCGCAACTGCAACCACCAACACCACCACCAACACCAACGCCGACCATGAGGTAGCCACCAGATATGACGACGATATGCCAATGGTTGTGGTGGAAGGAAAGGTTTATTGCCAGACTTGCGGATACAACAGACCACCATGGTCTACCTCTAGATCAGGTTGGTCTCTCTCTGGATTTGAGCCAATTCGAGGAGCTAGAGT...

CDS

Download CDS FASTA

612 bp · LXL04_012205|LXL04_012205|OH1004|CDS

ATGGCAAACAATCAGTTCATCATCATCATCACCACCATCCTCCTCTCCCTAGCCTTCCACAGCGCAACTGCAACCACCAACACCACCACCAACACCAACGCCGACCATGAGGTAGCCACCAGATATGACGACGATATGCCAATGGTTGTGGTGGAAGGAAAGGTTTATTGCCAGACTTGCGGATACAACAGACCACCATGGTCTACCTCTAGATCAGGTTGGTCTCTCTCTGGATTTGAGCCAATTCGAGGAGCTAGAGT...

Protein

Download Protein FASTA

203 aa · LXL04_012205|LXL04_012205|OH1004|PROTEIN

MANNQFIIIITTILLSLAFHSATATTNTTTNTNADHEVATRYDDDMPMVVVEGKVYCQTCGYNRPPWSTSRSGWSLSGFEPIRGARVRVICKNYKRRVSFYSAFSTDRKGYFYAELKNFKMNHLLLDHPLHACYVKLLSSPLDRCDIVSNMNNGIKGARLRFEDKVTYGRGYDQTVIYAAGPLAFRPSDCYPERDPIERDPFP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012205`
TK1151 ID	TkA02G581820
OH-1004 ID	LXL04_012205
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.000
Protein coverage (%)	TK1151 87.879 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012205

Location Chr03:8264295-8264906 (+)

Description Similar to AGP30: Non-classical arabinogalactan protein 30

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g33790`	Proteoglycan required for the timing of seed germination.	AtAGP30, an arabinogalactan-protein in the cell walls of the primary root, plays a role in root regeneration and seed germination.2003 · DOI: 10.1046/j.1365-313x.2003.01874.x
`At1g28290`	Proteoglycan that may contribute to the strengthening of cell walls.	Arabinogalactan protein 31 (AGP31), a putative network-forming protein in Arabidopsis thaliana cell walls?2014 · DOI: 10.1093/aob/mcu038
`At1g54970`	May contribute to cell wall structure in root hairs.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012205 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009625 response to insect Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:2000033 regulation of seed dormancy process Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0071944 cell periphery Cellular Component

KEGG gene cross-reference

ath:AT1G28290

ath:AT1G54970

ath:AT2G33790

zma:542292

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.639

Rank 1 · LXL04_012205 · OH-1004

Endoplasmic reticulum0.128

Rank 2 · LXL04_012205 · OH-1004

Cytoplasm0.102

Rank 3 · LXL04_012205 · OH-1004

Cell membrane0.081

Rank 4 · LXL04_012205 · OH-1004

Lysosome / Vacuole0.046

Rank 5 · LXL04_012205 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01190.26Pollen_Ole_e_150-153 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012205	`PF01190.26`	Pollen_Ole_e_1	50	153	9.7e-09	36.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P93013`	Arabidopsis thaliana	Non-classical arabinogalactan protein 30	29.530%	Swiss-Prot	weak database homology
`Q9FZA2`	Arabidopsis thaliana	Non-classical arabinogalactan protein 31	29.861%	Swiss-Prot	weak database homology
`Q9FZ35`	Arabidopsis thaliana	Proline-rich protein 1	34.021%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card