LXL04_011910 | RubberDandelionOmics

Gene overview

LXL04_011910

Reference: OH-1004 Chr: Chr03 Coordinates: 2632203-2633072 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

870 bp · LXL04_011910|LXL04_011910|OH1004|cDNA

ATGATTTTCGATTCTTGGATTTGGATAGATATTACGCCAGTAATGGGTTGTGCTTTTTCAGTCGACTGTAGCTGTATCGGTGATATATGTTTACCTAGAGATCCTAAAGTAAAAGAAACCGACAATGTCGGTACATCTGAACTCGCCGTGTTCTCACCTAAATCTTCATTCAAGGAAGACGATGGAGACGCAAATCAGAATCCAGAAGCAGGTATAACAAGACTACGAGGAGTTTCATCACAGTTTTTACCACCAGATGG...

CDS

Download CDS FASTA

870 bp · LXL04_011910|LXL04_011910|OH1004|CDS

ATGATTTTCGATTCTTGGATTTGGATAGATATTACGCCAGTAATGGGTTGTGCTTTTTCAGTCGACTGTAGCTGTATCGGTGATATATGTTTACCTAGAGATCCTAAAGTAAAAGAAACCGACAATGTCGGTACATCTGAACTCGCCGTGTTCTCACCTAAATCTTCATTCAAGGAAGACGATGGAGACGCAAATCAGAATCCAGAAGCAGGTATAACAAGACTACGAGGAGTTTCATCACAGTTTTTACCACCAGATGG...

Protein

Download Protein FASTA

289 aa · LXL04_011910|LXL04_011910|OH1004|PROTEIN

MIFDSWIWIDITPVMGCAFSVDCSCIGDICLPRDPKVKETDNVGTSELAVFSPKSSFKEDDGDANQNPEAGITRLRGVSSQFLPPDGSRIVVIPAGNYRLQYSYLSQRGYYPDALDKANQVSFCIHTPFGSNPNDHFFGVFDGHGEYGAQCSQFVKQKLCENLLRNSRFHVDLVDACHAAFLTTNSQLHADNNVDDSMSGTTAITVLVLGKTIYVANSGDSRAVIAEKRGTEIVAVDLSIDQTPYREDELEKVKLCGARV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011910`
TK1151 ID	TkA02G604780
OH-1004 ID	LXL04_011910
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	90.900
Protein coverage (%)	TK1151 100.000 / OH-1004 95.156 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011910

Location Chr03:2632203-2633072 (-)

Description Similar to At2g20050/At2g20040: Protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q9SL76`	Protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein.	No verified direct reference in this release
`At3g06270`	Probable protein phosphatase 2C 35.	No verified direct reference in this release
`At4g31750`	Protein phosphatase that modulates defense response to pathogenic bacteria, conferring resistance and promoting salicylic acid (SA) accumulation.	Arabidopsis proteins important for modulating defense responses to Pseudomonas syringae that secrete HopW1-1.2008 · DOI: 10.1111/j.1365-313x.2008.03439.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0646100`	Probable protein phosphatase 2C 65.	No verified direct reference in this release
`Os06g0526700`	Probable protein phosphatase 2C 55.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011910 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006470 protein dephosphorylation Biological Process

GO:0007165 signal transduction Biological Process

GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:1902531 regulation of intracellular signal transduction Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005952 cAMP-dependent protein kinase complex Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004691 cAMP-dependent protein kinase activity Molecular Function

GO:0004722 protein serine/threonine phosphatase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT2G20050

ath:AT3G06270

ath:AT4G31750

dosa:Os06g0526700

dosa:Os07g0646100

osa:4341187

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.262

Rank 1 · LXL04_011910 · OH-1004

Cell membrane0.246

Rank 2 · LXL04_011910 · OH-1004

Nucleus0.218

Rank 3 · LXL04_011910 · OH-1004

Endoplasmic reticulum0.143

Rank 4 · LXL04_011910 · OH-1004

Lysosome / Vacuole0.123

Rank 5 · LXL04_011910 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00481.27PP2C130-258 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011910	`PF00481.27`	PP2C	130	258	4.5e-21	76.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SL76`	Arabidopsis thaliana	Protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein	62.887%	Swiss-Prot	strong database homology
`Q7XJ53`	Arabidopsis thaliana	Probable protein phosphatase 2C 35	57.979%	Swiss-Prot	moderate database homology
`Q8RXV3`	Arabidopsis thaliana	Probable protein phosphatase 2C 59	40.000%	Swiss-Prot	weak database homology
`Q8H2T0`	Oryza sativa subsp. japonica	Probable protein phosphatase 2C 65	40.404%	Swiss-Prot	moderate database homology
`Q652Z7`	Oryza sativa subsp. japonica	Probable protein phosphatase 2C 55	33.178%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card