LXL04_011269 | RubberDandelionOmics

Gene overview

LXL04_011269

Reference: OH-1004 Chr: Chr02 Coordinates: 161520593-161521549 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

957 bp · LXL04_011269|LXL04_011269|OH1004|cDNA

ATGGAACCCACCACAATCGCCGCCGCCGCATCCCTCCCCACCCGTCGCAGAAAACGAAAGATTGTCGTCATCATGGGTGCAACCGGCGCCGGGAAATCCCGGCTCTCAATCGATCTCGCTACTAGATTTTTTAAAAACTCAGAGATCATCAACTCCGATAAAATGCAAGTATACGCCGGACTTGATATCACCACCAACAAAATCACAATGCAAGAGCAGCTCGGTGTCCCTCACCACCTTCTCGGAGCGATTGACCCAAC...

CDS

Download CDS FASTA

957 bp · LXL04_011269|LXL04_011269|OH1004|CDS

ATGGAACCCACCACAATCGCCGCCGCCGCATCCCTCCCCACCCGTCGCAGAAAACGAAAGATTGTCGTCATCATGGGTGCAACCGGCGCCGGGAAATCCCGGCTCTCAATCGATCTCGCTACTAGATTTTTTAAAAACTCAGAGATCATCAACTCCGATAAAATGCAAGTATACGCCGGACTTGATATCACCACCAACAAAATCACAATGCAAGAGCAGCTCGGTGTCCCTCACCACCTTCTCGGAGCGATTGACCCAAC...

Protein

Download Protein FASTA

318 aa · LXL04_011269|LXL04_011269|OH1004|PROTEIN

MEPTTIAAAASLPTRRRKRKIVVIMGATGAGKSRLSIDLATRFFKNSEIINSDKMQVYAGLDITTNKITMQEQLGVPHHLLGAIDPTKSVFTPMEFRNVASEIISEIKSRRGLPLVVGGSNSLIYSLVTKRYDPKSDVFNGPDPHPVSSEFRYECCFIWVDVSLPVLNQYLSKRVDEMLDSGMFEELAEFFRSEDHKRVNRCGLGQAIGVPEFETYFKKFPGFRRMEGSDFEEDVMGQAEAYDEAVRRIKDNTCQLAKKQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011269`
TK1151 ID	TkA03G578880
OH-1004 ID	LXL04_011269
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 84.046 / OH-1004 92.767 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011269

Location Chr02:161520593-161521549 (+)

Description Similar to Adenylate isopentenyltransferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g68460`	Involved in cytokinin biosynthesis.	Roles of Arabidopsis ATP/ADP isopentenyltransferases and tRNA isopentenyltransferases in cytokinin biosynthesis.2006 · DOI: 10.1073/pnas.0603522103
`At3g19160`	Involved in cytokinin biosynthesis.	Identification of genes encoding adenylate isopentenyltransferase, a cytokinin biosynthesis enzyme, in Arabidopsis thaliana.2001 · DOI: 10.1074/jbc.m102130200 The Arabidopsis AtIPT8/PGA22 gene encodes an isopentenyl transferase that is involved in de novo cytokinin biosynthesis.2003 · DOI: 10.1104/pp.011494
`At4g24650`	Involved in cytokinin biosynthesis.	No verified direct reference in this release
`At1g25410`	Involved in cytokinin biosynthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011269 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006400 tRNA modification Biological Process

GO:0009691 cytokinin biosynthetic process Biological Process

GO:0034265 isopentenyl adenine biosynthetic process Biological Process

GO:0080117 secondary growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0009824 AMP dimethylallyltransferase activity Molecular Function

GO:0052381 tRNA dimethylallyltransferase activity Molecular Function

KEGG gene cross-reference

ag:AAS94327

ath:AT1G25410

ath:AT1G68460

ath:AT3G19160

ath:AT4G24650

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.364

Rank 1 · LXL04_011269 · OH-1004

Plastid0.291

Rank 2 · LXL04_011269 · OH-1004

Cytoplasm0.269

Rank 3 · LXL04_011269 · OH-1004

Mitochondrion0.122

Rank 4 · LXL04_011269 · OH-1004

Peroxisome0.043

Rank 5 · LXL04_011269 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01745.23IPT20-132 aa

PF01715.24IPPT56-130 aa

PF01715.24IPPT148-261 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011269	`PF01745.23`	IPT	20	132	4.2e-07	30.3
LXL04_011269	`PF01715.24`	IPPT	56	130	8.5e-34	118.0
LXL04_011269	`PF01715.24`	IPPT	148	261	8.5e-34	118.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94ID3`	Arabidopsis thaliana	Adenylate isopentenyltransferase 1, chloroplastic	55.776%	Swiss-Prot	strong database homology
`Q9LJL4`	Arabidopsis thaliana	Adenylate isopentenyltransferase 8, chloroplastic	50.333%	Swiss-Prot	strong database homology
`Q9SB60`	Arabidopsis thaliana	Adenylate isopentenyltransferase 4	50.165%	Swiss-Prot	strong database homology
`Q9C6L1`	Arabidopsis thaliana	Adenylate isopentenyltransferase 6, chloroplastic	48.366%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card