LXL04_009804 | RubberDandelionOmics

Gene overview

LXL04_009804

Reference: OH-1004 Chr: Chr02 Coordinates: 133972492-133973412 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

708 bp · LXL04_009804|LXL04_009804|OH1004|cDNA

ATGGTGACTAGTACTAGGGGTTCTCTTAAAGAAAAGGAAACCAgtgaagaagagaaagaaagaaacgGCAGAAGAAGAATTGGGGAATTTCTGTCAGTGAATGATGATTTCATACGTCCAACCCAAGATTCCAAAACTCTCCGGGAATGGGCCGAACACAGGCTGATGATGATCGAGATGAAGAAAAGAACAGAACACATCGTCACGGAATCTCCAAAATCTCCAAACACAGTACTTTCTTCGTTAGGTCCAAGCAGTTC...

CDS

Download CDS FASTA

708 bp · LXL04_009804|LXL04_009804|OH1004|CDS

ATGGTGACTAGTACTAGGGGTTCTCTTAAAGAAAAGGAAACCAGTGAAGAAGAGAAAGAAAGAAACGGCAGAAGAAGAATTGGGGAATTTCTGTCAGTGAATGATGATTTCATACGTCCAACCCAAGATTCCAAAACTCTCCGGGAATGGGCCGAACACAGGCTGATGATGATCGAGATGAAGAAAAGAACAGAACACATCGTCACGGAATCTCCAAAATCTCCAAACACAGTACTTTCTTCGTTAGGTCCAAGCAGTTC...

Protein

Download Protein FASTA

235 aa · LXL04_009804|LXL04_009804|OH1004|PROTEIN

MVTSTRGSLKEKETSEEEKERNGRRRIGEFLSVNDDFIRPTQDSKTLREWAEHRLMMIEMKKRTEHIVTESPKSPNTVLSSLGPSSSNTTSSSRPQRFNHSFGCPEHRNVNDHMEVPPEVRAYIENIEGSENVKFVTEKKLTATDVNPSQCRLLMPFKQIPRKDLEFPGPKEEASVLLYVPEKREHYDLVLTEWDMKSTRNYSLKKGWNNVVKENQLRKNMVVQIWEDDERLFKL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009804`
TK1151 ID	TkA03G474130
OH-1004 ID	LXL04_009804
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	99.100
Protein coverage (%)	TK1151 90.400 / OH-1004 96.170 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009804

Location Chr02:133972492-133973412 (+)

Description Similar to At3g49610: Putative B3 domain-containing protein At3g49610

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g49610`	Putative B3 domain-containing protein At3g49610.	No verified direct reference in this release
`At1g32030`	B3 domain-containing protein At1g32030.	No verified direct reference in this release
`At3g25182`	B3 domain-containing protein At3g25182.	No verified direct reference in this release
`At2g31720`	B3 domain-containing protein At2g31720.	No verified direct reference in this release
`At3g24850`	Putative B3 domain-containing protein At3g24850.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009804 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G32030

ath:AT2G31720

ath:AT3G24850

ath:AT3G49610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.956

Rank 1 · LXL04_009804 · OH-1004

Cytoplasm0.130

Rank 2 · LXL04_009804 · OH-1004

Cell membrane0.023

Rank 3 · LXL04_009804 · OH-1004

Endoplasmic reticulum0.012

Rank 4 · LXL04_009804 · OH-1004

Mitochondrion0.012

Rank 5 · LXL04_009804 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03754.20At2g31720-like123-226 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009804	`PF03754.20`	At2g31720-like	123	226	8e-18	65.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SCJ8`	Arabidopsis thaliana	Putative B3 domain-containing protein At3g49610	30.882%	Swiss-Prot	weak database homology
`Q9C6X0`	Arabidopsis thaliana	B3 domain-containing protein At1g32030	31.008%	Swiss-Prot	weak database homology
`Q9LSF7`	Arabidopsis thaliana	B3 domain-containing protein At3g25182	27.344%	Swiss-Prot	weak database homology
`Q8RV83`	Arabidopsis thaliana	B3 domain-containing protein At2g31720	31.579%	Swiss-Prot	moderate database homology
`Q9LRX6`	Arabidopsis thaliana	Putative B3 domain-containing protein At3g24850	25.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card