LXL04_009795 | RubberDandelionOmics

Gene overview

LXL04_009795

Reference: OH-1004 Chr: Chr02 Coordinates: 133543042-133544330 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

864 bp · LXL04_009795|LXL04_009795|OH1004|cDNA

ATGGCGGTTCAAGTTTGCTCATCCCGCCCCTTGGACCCCAAAGCCTCCCCTTACCACAAAATGCCCACTACAAATCTCTGCATCTACGCACCCCCTCCATCTCCGGCGTACTATCACATCCTGCCACCGGTTATTTCACTCTATCGTTTCTATTCTTACAATGTTCATTTCCAACCGGCGCCGGTTAAATCATTACCGCTTTCTTTTCGCCCGCCACCCTCACCGGAAAAGAAGACGAAGCTCTCACTGGGCCCTGTTCC...

CDS

Download CDS FASTA

864 bp · LXL04_009795|LXL04_009795|OH1004|CDS

ATGGCGGTTCAAGTTTGCTCATCCCGCCCCTTGGACCCCAAAGCCTCCCCTTACCACAAAATGCCCACTACAAATCTCTGCATCTACGCACCCCCTCCATCTCCGGCGTACTATCACATCCTGCCACCGGTTATTTCACTCTATCGTTTCTATTCTTACAATGTTCATTTCCAACCGGCGCCGGTTAAATCATTACCGCTTTCTTTTCGCCCGCCACCCTCACCGGAAAAGAAGACGAAGCTCTCACTGGGCCCTGTTCC...

Protein

Download Protein FASTA

287 aa · LXL04_009795|LXL04_009795|OH1004|PROTEIN

MAVQVCSSRPLDPKASPYHKMPTTNLCIYAPPPSPAYYHILPPVISLYRFYSYNVHFQPAPVKSLPLSFRPPPSPEKKTKLSLGPVPSGPRVTKSRLPVYRRRKANNAVRVAKSCDGGNEQKAQRWKNRSGGYQQILPLDKKTTTVMIKNIPNKYTRKLMIQTLDNHCKAENKTIKNFVTAYDFLYLPIDFNRRVNAGFAFVNFTTPESAARFKEAFHCKRWDFFDSPKIAEITRARIQGKRFLINNCKTMDFTYGSEED...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009795`
TK1151 ID	TkA03G472190
OH-1004 ID	LXL04_009795
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009795

Location Chr02:133543042-133544330 (-)

Description Similar to TE1: Protein terminal ear1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g61960`	Probable RNA-binding transcriptional activator that plays a role in meiosis and vegetative growth.	No verified direct reference in this release
`At5g07290`	Probable RNA-binding protein that plays a role in meiosis and vegetative growth.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2WY46`	Probable RNA-binding protein.	No verified direct reference in this release
`Os01g0907900`	Probable RNA-binding protein.	PLASTOCHRON2 regulates leaf initiation and maturation in rice.2006 · DOI: 10.1105/tpc.105.037622

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009795 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000381 regulation of alternative mRNA splicing, via spliceosome Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0045836 positive regulation of meiotic nuclear division Biological Process

GO:0045927 positive regulation of growth Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0005634 nucleus Cellular Component

GO:0016607 nuclear speck Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT5G07290

ath:AT5G61960

dosa:Os01g0907900

zma:541683

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.741

Rank 1 · LXL04_009795 · OH-1004

Cytoplasm0.259

Rank 2 · LXL04_009795 · OH-1004

Cell membrane0.066

Rank 3 · LXL04_009795 · OH-1004

Endoplasmic reticulum0.048

Rank 4 · LXL04_009795 · OH-1004

Plastid0.023

Rank 5 · LXL04_009795 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04059.19RRM_2144-247 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009795	`PF04059.19`	RRM_2	144	247	2.1e-30	105.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W4I9`	Arabidopsis thaliana	Protein MEI2-like 1	48.649%	Swiss-Prot	weak database homology
`Q9LYN7`	Arabidopsis thaliana	Protein MEI2-like 4	40.299%	Swiss-Prot	weak database homology
`A2WY46`	Oryza sativa subsp. indica	Protein terminal ear1 homolog	48.889%	Swiss-Prot	weak database homology
`Q0JGS5`	Oryza sativa subsp. japonica	Protein terminal ear1 homolog	48.889%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card