LXL04_009615 | RubberDandelionOmics

Gene overview

LXL04_009615

Reference: OH-1004 Chr: Chr02 Coordinates: 129772136-129774111 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1317 bp · LXL04_009615|LXL04_009615|OH1004|cDNA

ATGAAGTCCCGATGGTGTTTTTCAATGATATCGGTGTTTCTATTCACTATTTTCAGTTTCACAGATTGTTATGACCCACTGGATCCAAATGGAAACGTTACAGTAACTTTCGACATAATTCAATGGACACCTGATGGCTATATGGCAAGGGTAACTATCCAAAACTATTATCAATATCGCCATGTAGACGACCCGGGATGGAAATTAGGTTTTACATGGGTCAACAACGAGATCATCTGGTCAATATCGGGTGCTATTGC...

CDS

Download CDS FASTA

1317 bp · LXL04_009615|LXL04_009615|OH1004|CDS

ATGAAGTCCCGATGGTGTTTTTCAATGATATCGGTGTTTCTATTCACTATTTTCAGTTTCACAGATTGTTATGACCCACTGGATCCAAATGGAAACGTTACAGTAACTTTCGACATAATTCAATGGACACCTGATGGCTATATGGCAAGGGTAACTATCCAAAACTATTATCAATATCGCCATGTAGACGACCCGGGATGGAAATTAGGTTTTACATGGGTCAACAACGAGATCATCTGGTCAATATCGGGTGCTATTGC...

Protein

Download Protein FASTA

438 aa · LXL04_009615|LXL04_009615|OH1004|PROTEIN

MKSRWCFSMISVFLFTIFSFTDCYDPLDPNGNVTVTFDIIQWTPDGYMARVTIQNYYQYRHVDDPGWKLGFTWVNNEIIWSISGAIATHRGNCSQFKDEVPHCCMPTAEIVDLMAGAQPPNSPENCCRGGVIAAWAINPQQSSSSFDMVVGNLQVNSMLQMPVNLTLQAPGPGYTCSPTEEFPPTVALVVGGRRQEEVFKTWKSRCTYSSYLANKTPVCCVSLSTFYSPQITTCPQCSCGCRPADKTTSSCISGFSNSLE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009615`
TK1151 ID	TkA03G451400
OH-1004 ID	LXL04_009615
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009615

Location Chr02:129772136-129774111 (+)

Description Similar to BC1L6: COBRA-like protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02210`	COBRA-like protein 1.	No verified direct reference in this release
`At3g29810`	COBRA-like protein 2.	No verified direct reference in this release
`At5g15630`	COBRA-like protein 4.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0604300`	Involved in determining the orientation of cell expansion, probably by playing an important role in cellulose deposition.	No verified direct reference in this release
`Os03g0416300`	COBRA-like protein 2.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009615 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009664 plant-type cell wall organization Biological Process

GO:0009832 plant-type cell wall biogenesis Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0010214 seed coat development Biological Process

GO:0010215 cellulose microfibril organization Biological Process

GO:0048316 seed development Biological Process

GO:0048354 mucilage biosynthetic process involved in seed coat development Biological Process

GO:0052324 plant-type cell wall cellulose biosynthetic process Biological Process

GO:2001006 regulation of cellulose biosynthetic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005797 Golgi medial cisterna Cellular Component

KEGG gene cross-reference

ath:AT3G02210

ath:AT3G29810

ath:AT5G15630

dosa:Os03g0416300

dosa:Os07g0604300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.759

Rank 1 · LXL04_009615 · OH-1004

Cytoplasm0.110

Rank 2 · LXL04_009615 · OH-1004

Extracellular0.102

Rank 3 · LXL04_009615 · OH-1004

Endoplasmic reticulum0.092

Rank 4 · LXL04_009615 · OH-1004

Lysosome / Vacuole0.059

Rank 5 · LXL04_009615 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04833.21COBRA_N47-209 aa

PF25079.2COB_C219-408 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009615	`PF04833.21`	COBRA_N	47	209	6.8e-51	173.2
LXL04_009615	`PF25079.2`	COB_C	219	408	6e-41	141.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SRT7`	Arabidopsis thaliana	COBRA-like protein 1	43.567%	Swiss-Prot	moderate database homology
`Q8L8Q7`	Arabidopsis thaliana	COBRA-like protein 2	45.823%	Swiss-Prot	moderate database homology
`Q9LFW3`	Arabidopsis thaliana	COBRA-like protein 4	44.471%	Swiss-Prot	moderate database homology
`Q6Z4G8`	Oryza sativa subsp. japonica	COBRA-like protein 1	46.731%	Swiss-Prot	moderate database homology
`Q75IW1`	Oryza sativa subsp. japonica	COBRA-like protein 2	46.588%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card