Gene Card
Gene overview
cDNA / CDS / Protein Sequences
690 bp · LXL04_009487|LXL04_009487|OH1004|cDNA
ATGTCGAAGGCGAGGCGTCGCCTCGCAAAGATGGAGTTATCCCCTTCGGTTTCTAAATCGCACAATTCCCTCCTCTTCTCCTCTTCTCCTCTTCAGTCGACACTCGACAGTCTTCAATCTCAATCGATTTTCCCTCCTGGCTTCCTGTTACTCAAGCTGTCAAGCATCTCACTGAATCAGTCGCCCTCGGCCTTCGATTTTCTCGATTTCAGTTCGAAATTTCCCCTTCAGAGTCTCAGCATAAAACAGAGAACGATTAT...
690 bp · LXL04_009487|LXL04_009487|OH1004|CDS
ATGTCGAAGGCGAGGCGTCGCCTCGCAAAGATGGAGTTATCCCCTTCGGTTTCTAAATCGCACAATTCCCTCCTCTTCTCCTCTTCTCCTCTTCAGTCGACACTCGACAGTCTTCAATCTCAATCGATTTTCCCTCCTGGCTTCCTGTTACTCAAGCTGTCAAGCATCTCACTGAATCAGTCGCCCTCGGCCTTCGATTTTCTCGATTTCAGTTCGAAATTTCCCCTTCAGAGTCTCAGCATAAAACAGAGAACGATTAT...
Protein
Download Protein FASTA229 aa · LXL04_009487|LXL04_009487|OH1004|PROTEIN
MSKARRRLAKMELSPSVSKSHNSLLFSSSPLQSTLDSLQSQSIFPPGFLLLKLSSISLNQSPSAFDFLDFSSKFPLQSLSIKQRTIILQRGLADRSPAVTKECLKLLKDEWLMKSCNANPIELLKYLDVETYESIGVSVMEALLKSGLVKLHGGQSINQFLSSNSNTTEDHSVQQVDAKVALYLRTLCKHLQTEAQSKGSDAAMTSGSEAVVYASEASDSNEYRKSIIR
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_009487 |
|---|---|
| TK1151 ID | TkA03G441790 |
| OH-1004 ID | LXL04_009487 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 86.500 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_009487 |
|---|---|
| Location | Chr02:127272743-127273907 (+) |
| Description | Similar to NCAPG: Condensin complex subunit 3 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0007076 mitotic chromosome condensation Biological Process GO:0051301 cell division Biological Process GO:0051984 positive regulation of chromosome segregation Biological Process GO:1905820 positive regulation of chromosome separation Biological Process GO:1905821 positive regulation of chromosome condensation Biological Process GO:0000779 condensed chromosome, centromeric region Cellular Component GO:0000793 condensed chromosome Cellular Component GO:0000794 condensed nuclear chromosome Cellular Component GO:0000796 condensin complex Cellular Component GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component |
| KEGG gene cross-reference | hsa:64151 xla:398088 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.