Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1302 bp · LXL04_009416|LXL04_009416|OH1004|cDNA
ATGAATAGAAACGAACCGGCCATCGGCATTGACCTCGGAACAACCTACACATGCGTCGCCGTTTGGAAGTATGATCGCATCGAAATCATTCCCAATAATCAAGGCAATAGAACGACACCGTCTTGTGTTGTTTTCGTTGATGCAGCACGTCTCATTGGGGATGGCGCCAAGAACCAAGCCGCCATCAACCCTACTAACACCATATTTGATGCTAAGAGGTTGATTGGAAGGAAGTTTAGTGATTCCAAAGTGCAAGATGA...
1302 bp · LXL04_009416|LXL04_009416|OH1004|CDS
ATGAATAGAAACGAACCGGCCATCGGCATTGACCTCGGAACAACCTACACATGCGTCGCCGTTTGGAAGTATGATCGCATCGAAATCATTCCCAATAATCAAGGCAATAGAACGACACCGTCTTGTGTTGTTTTCGTTGATGCAGCACGTCTCATTGGGGATGGCGCCAAGAACCAAGCCGCCATCAACCCTACTAACACCATATTTGATGCTAAGAGGTTGATTGGAAGGAAGTTTAGTGATTCCAAAGTGCAAGATGA...
Protein
Download Protein FASTA433 aa · LXL04_009416|LXL04_009416|OH1004|PROTEIN
MNRNEPAIGIDLGTTYTCVAVWKYDRIEIIPNNQGNRTTPSCVVFVDAARLIGDGAKNQAAINPTNTIFDAKRLIGRKFSDSKVQDDMKLWPFKVIEGPADTPKIAVSYQGEEKEFLAEEISFMILGKMKEISEAYMGKPVKNAVITVPAYFTDSQCQATKDAGTIAGPKVRSMLQNLFNGKELYKSLNPDEAVAILAEKLSGDHENDKRCRDLVLLDVTPLSLGVQSKGEVLTVVVPRNTPIPTKKFKRCYTFKSSINI...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_009416 |
|---|---|
| TK1151 ID | TkA03G435440 |
| OH-1004 ID | LXL04_009416 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 73.700 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_009416 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:125589177-125590653 (-) | |||||||||
| Description | Similar to HSC-I: Heat shock cognate 70 kDa protein 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006351 DNA-templated transcription Biological Process GO:0006457 protein folding Biological Process GO:0006950 response to stress Biological Process GO:0009408 response to heat Biological Process GO:0009615 response to virus Biological Process GO:0010187 negative regulation of seed germination Biological Process GO:0010286 heat acclimation Biological Process GO:0042026 protein refolding Biological Process GO:0042742 defense response to bacterium Biological Process GO:0050832 defense response to fungus Biological Process GO:0090332 stomatal closure Biological Process GO:0098542 defense response to other organism Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT5G02500 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00012.27HSP707-168 aaPF00012.27HSP70169-406 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_009416 | PF00012.27 | HSP70 | 7 | 168 | 1.8e-117 | 393.8 |
| LXL04_009416 | PF00012.27 | HSP70 | 169 | 406 | 1.8e-117 | 393.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.