LXL04_009318 | RubberDandelionOmics

Gene overview

LXL04_009318

Reference: OH-1004 Chr: Chr02 Coordinates: 122788110-122789312 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

585 bp · LXL04_009318|LXL04_009318|OH1004|cDNA

ATGGTGGACTTTAGTAGAGTGCAAAAGGAGCTTCAAGAATGTAACAGAGACATCAATGTCTCGGGTATCAGCGTAAACCCTAAATCCGACAATCTCACCAATTTGATCGGCACAATTCCCGGCCCAATCGGTACTCCGTACGAAGGCGGAACTTTCAAGATTGATATTAATTTACCTGATGGATACCCATTCGAGCCACCAAAGATGAAATTTGCAACTAAAGTTTGGCACCCCAACATCAGCAGCCAAAGTGGAGCCAT...

CDS

Download CDS FASTA

585 bp · LXL04_009318|LXL04_009318|OH1004|CDS

ATGGTGGACTTTAGTAGAGTGCAAAAGGAGCTTCAAGAATGTAACAGAGACATCAATGTCTCGGGTATCAGCGTAAACCCTAAATCCGACAATCTCACCAATTTGATCGGCACAATTCCCGGCCCAATCGGTACTCCGTACGAAGGCGGAACTTTCAAGATTGATATTAATTTACCTGATGGATACCCATTCGAGCCACCAAAGATGAAATTTGCAACTAAAGTTTGGCACCCCAACATCAGCAGCCAAAGTGGAGCCAT...

Protein

Download Protein FASTA

194 aa · LXL04_009318|LXL04_009318|OH1004|PROTEIN

MVDFSRVQKELQECNRDINVSGISVNPKSDNLTNLIGTIPGPIGTPYEGGTFKIDINLPDGYPFEPPKMKFATKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSIQALLSAPEPDDPQDAVVAQQYLKDYQTFASTARYWTESFAKISSLGVEEKVQKLVEMGFPEGLVRSTLEVVGGDENMALEKLCSA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009318`
TK1151 ID	TkA03G418200
OH-1004 ID	LXL04_009318
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009318

Location Chr02:122788110-122789312 (+)

Description Similar to UBC27: Ubiquitin-conjugating enzyme E2 27

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g50870`	Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009318 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000209 protein polyubiquitination Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0010800 positive regulation of peptidyl-threonine phosphorylation Biological Process

GO:0010994 free ubiquitin chain polymerization Biological Process

GO:0016050 vesicle organization Biological Process

GO:0032434 regulation of proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0035458 cellular response to interferon-beta Biological Process

GO:0036503 ERAD pathway Biological Process

GO:0060337 type I interferon-mediated signaling pathway Biological Process

GO:0060340 positive regulation of type I interferon-mediated signaling pathway Biological Process

GO:0070936 protein K48-linked ubiquitination Biological Process

GO:1903265 positive regulation of tumor necrosis factor-mediated signaling pathway Biological Process

KEGG gene cross-reference

ath:AT5G50870

cel:CELE_C06E2.3

mmu:53323

sce:YDR177W

spo:2540277

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.612

Rank 1 · LXL04_009318 · OH-1004

Nucleus0.576

Rank 2 · LXL04_009318 · OH-1004

Mitochondrion0.057

Rank 3 · LXL04_009318 · OH-1004

Cell membrane0.054

Rank 4 · LXL04_009318 · OH-1004

Endoplasmic reticulum0.053

Rank 5 · LXL04_009318 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00179.32UQ_con6-144 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009318	`PF00179.32`	UQ_con	6	144	9.6e-47	158.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FI61`	Arabidopsis thaliana	Ubiquitin-conjugating enzyme E2 27	79.897%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card