RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_008831
Reference: OH-1004 Chr: Chr02 Coordinates: 109881891-109885292 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3402 bp · LXL04_008831|LXL04_008831|OH1004|cDNA

ATGCCAACGGTCACTTTTCTTATACTTGCATTTCTCGCCACCGTGCTATTCTGCGCCACTCTCTCCACCACCGCTACAACGACGGAGATAGATGCTCTAACATCCTTCAAAGAAAATGTACGCGATCCACTCGGCGCGTTGGATGCCTGGAATACTTCTACGCCGGCTGCCCCGTGTGACTGGCGTGGGATTTCCTGTACAGACGGCAGAGTTCGTGAAATTCGTTTAGCTCGGCTTGGTTTATCTGGCCGGCTGAGTAG...

CDS

Download CDS FASTA

3402 bp · LXL04_008831|LXL04_008831|OH1004|CDS

ATGCCAACGGTCACTTTTCTTATACTTGCATTTCTCGCCACCGTGCTATTCTGCGCCACTCTCTCCACCACCGCTACAACGACGGAGATAGATGCTCTAACATCCTTCAAAGAAAATGTACGCGATCCACTCGGCGCGTTGGATGCCTGGAATACTTCTACGCCGGCTGCCCCGTGTGACTGGCGTGGGATTTCCTGTACAGACGGCAGAGTTCGTGAAATTCGTTTAGCTCGGCTTGGTTTATCTGGCCGGCTGAGTAG...

Protein

Download Protein FASTA

1133 aa · LXL04_008831|LXL04_008831|OH1004|PROTEIN

MPTVTFLILAFLATVLFCATLSTTATTTEIDALTSFKENVRDPLGALDAWNTSTPAAPCDWRGISCTDGRVREIRLARLGLSGRLSSRISELSQLRTLSLHTNNFNGSIPSALSQCSLLRVVYLQYNYFSGVLPPAFGNLTNLLVLNVAHNFLSGELPANLPPKVRYLDVSSNAVSGNIPANLSVSSEIQLINLSFNALSGQVPPVIGDFQNLQYLFLDSNNLYGTLPSAIANCSSLIHLSADNNQLQGLIPASIGNLLN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_008831
TK1151 IDTkA03G325090
OH-1004 IDLXL04_008831
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)97.700
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_008831
LocationChr02:109881891-109885292 (-)
DescriptionSimilar to At4g36180: Probable LRR receptor-like serine/threonine-protein kinase At4g36180
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g36180 Probable LRR receptor-like serine/threonine-protein kinase At4g36180. No verified direct reference in this release
At5g46330 Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of flagellin (flg22), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs). No verified direct reference in this release
At1g73080 Acts as a receptor for PEP defense peptides.
The cell surface leucine-rich repeat receptor for AtPep1, an endogenous peptide elicitor in Arabidopsis, is functional in transgenic tobacco cells.2006 · DOI: 10.1073/pnas.0603729103
BIK1 interacts with PEPRs to mediate ethylene-induced immunity.2013 · DOI: 10.1073/pnas.1215543110

Rice

Reference gene IDPossible functionPapers / DOI
Os04g0576900 Functions in the early stages of organ development by regulating cell division rate.
XIAO is involved in the control of organ size by contributing to the regulation of signaling and homeostasis of brassinosteroids and cell cycling in rice.2012 · DOI: 10.1111/j.1365-313x.2011.04877.x
Os04g0618700 Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of flagellin (flg22), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs).
Analysis of flagellin perception mediated by flg22 receptor OsFLS2 in rice.2008 · DOI: 10.1094/mpmi-21-12-1635
Rice OsFLS2-Mediated Perception of Bacterial Flagellins Is Evaded by Xanthomonas oryzae pvs. oryzae and oryzicola.2015 · DOI: 10.1016/j.molp.2015.01.012
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_008831 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006898 receptor-mediated endocytosis Biological Process
GO:0006952 defense response Biological Process
GO:0006955 immune response Biological Process
GO:0009611 response to wounding Biological Process
GO:0009742 brassinosteroid mediated signaling pathway Biological Process
GO:0009753 response to jasmonic acid Biological Process
GO:0016045 detection of bacterium Biological Process
GO:0042742 defense response to bacterium Biological Process
GO:0045087 innate immune response Biological Process
GO:0052544 defense response by callose deposition in cell wall Biological Process
GO:0090696 post-embryonic plant organ development Biological Process
GO:0140426 pathogen-associated molecular pattern receptor signaling pathway Biological Process
KEGG gene cross-reference
ath:AT1G73080
ath:AT4G36180
ath:AT5G46330
dosa:Os04g0576900
dosa:Os04g0618700
osa:4336741
osa:4337016
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.872
Rank 1 · LXL04_008831 · OH-1004
Endoplasmic reticulum0.080
Rank 2 · LXL04_008831 · OH-1004
Cytoplasm0.064
Rank 3 · LXL04_008831 · OH-1004
Nucleus0.048
Rank 4 · LXL04_008831 · OH-1004
Lysosome / Vacuole0.023
Rank 5 · LXL04_008831 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_228-67 aa
PF13855.13LRR_894-151 aa
PF13855.13LRR_8119-173 aa
PF23598.2LRR_14196-268 aa
PF13855.13LRR_8212-271 aa
PF13855.13LRR_8312-371 aa
PF23598.2LRR_14313-415 aa
PF23598.2LRR_14381-466 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_008831PF08263.18LRRNT_228671.3e-0938.8
LXL04_008831PF13855.13LRR_8941515.9e-60199.6
LXL04_008831PF13855.13LRR_81191735.9e-60199.6
LXL04_008831PF23598.2LRR_141962686.6e-40137.7
LXL04_008831PF13855.13LRR_82122715.9e-60199.6
LXL04_008831PF13855.13LRR_83123715.9e-60199.6
LXL04_008831PF23598.2LRR_143134156.6e-40137.7
LXL04_008831PF23598.2LRR_143814666.6e-40137.7
LXL04_008831PF13855.13LRR_83844435.9e-60199.6
LXL04_008831PF12799.14LRR_44324667.1e-45150.7
LXL04_008831PF23598.2LRR_144876056.6e-40137.7
LXL04_008831PF13855.13LRR_85035625.9e-60199.6
LXL04_008831PF13855.13LRR_85766355.9e-60199.6
LXL04_008831PF12799.14LRR_45766127.1e-45150.7
LXL04_008831PF23598.2LRR_145777176.6e-40137.7
LXL04_008831PF13855.13LRR_86487075.9e-60199.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
C0LGS2Arabidopsis thalianaProbable LRR receptor-like serine/threonine-protein kinase At4g3618059.507%Swiss-Protstrong database homology
Q9FL28Arabidopsis thalianaLRR receptor-like serine/threonine-protein kinase FLS233.864%Swiss-Protmoderate database homology
Q9SSL9Arabidopsis thalianaLeucine-rich repeat receptor-like protein kinase PEPR134.386%Swiss-Protmoderate database homology
G9LZD7Oryza sativa subsp. japonicaProbable inactive leucine-rich repeat receptor kinase XIAO54.352%Swiss-Protstrong database homology
Q0JA29Oryza sativa subsp. japonicaLRR receptor-like serine/threonine-protein kinase FLS232.912%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser