LXL04_008711 | RubberDandelionOmics

Gene overview

LXL04_008711

Reference: OH-1004 Chr: Chr02 Coordinates: 106603757-106605363 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1143 bp · LXL04_008711|LXL04_008711|OH1004|cDNA

ATGCTCCCCGATCTGCAGTACCAAAGGCACATGATAGTTTTAATCGATGTGATTGTGTGTTTAGCTGCTTTTTGGCAGCCAGATGATGCAAGAAGTAAGATGTTCAACAATAATTCAGAAGGGACTAAAGACTTTTCAGGAAAGCAAGAAGCAAATGGAAATGAGCCTATAATATTTCCTAAAAATACATCAACTTCAAGACAATGGGCAGGTTTCAAGAACCCAAGAATCGTAAGGGTGTCAAAGGCTTTTGGAGGGAA...

CDS

Download CDS FASTA

1143 bp · LXL04_008711|LXL04_008711|OH1004|CDS

ATGCTCCCCGATCTGCAGTACCAAAGGCACATGATAGTTTTAATCGATGTGATTGTGTGTTTAGCTGCTTTTTGGCAGCCAGATGATGCAAGAAGTAAGATGTTCAACAATAATTCAGAAGGGACTAAAGACTTTTCAGGAAAGCAAGAAGCAAATGGAAATGAGCCTATAATATTTCCTAAAAATACATCAACTTCAAGACAATGGGCAGGTTTCAAGAACCCAAGAATCGTAAGGGTGTCAAAGGCTTTTGGAGGGAA...

Protein

Download Protein FASTA

380 aa · LXL04_008711|LXL04_008711|OH1004|PROTEIN

MLPDLQYQRHMIVLIDVIVCLAAFWQPDDARSKMFNNNSEGTKDFSGKQEANGNEPIIFPKNTSTSRQWAGFKNPRIVRVSKAFGGKDRHSKVCTVKGLRDRRIRLSVPTAVQLYDLQDKLGLNQPSKVIDWLLDSTKDDIDKLPPLQMLPGDFNQFIHPPPPPLIPQDLNSPQISFSQFLSNPNATFAKDVGNRTLLYTKQAIKFDNDYDHHGISGDNQRMKGKEAVVENKWQEQENGDGNGGLNFFPIPQYSHPGLFP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008711`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008711

Location Chr02:106603757-106605363 (+)

Description Similar to TCP5: Transcription factor TCP5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g60970`	Plays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164).	No verified direct reference in this release
`At3g02150`	Plays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164).	Involvement of a nuclear-encoded basic helix-loop-helix protein in transcription of the light-responsive promoter of psbD.2001 · DOI: 10.1104/pp.125.2.595
`At5g08070`	Plays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164).	No verified direct reference in this release
`At1g30210`	Plays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164).	ABAP1 is a novel plant Armadillo BTB protein involved in DNA replication and transcription.2008 · DOI: 10.1038/emboj.2008.191
`At4g18390`	Plays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164).	TCP2 positively regulates HY5/HYH and photomorphogenesis in Arabidopsis.2016 · DOI: 10.1093/jxb/erv495

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008711 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009408 response to heat Biological Process

GO:0009637 response to blue light Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0010150 leaf senescence Biological Process

GO:0031347 regulation of defense response Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0048366 leaf development Biological Process

GO:2000032 regulation of secondary shoot formation Biological Process

GO:2000306 positive regulation of photomorphogenesis Biological Process

KEGG gene cross-reference

ath:AT1G30210

ath:AT3G02150

ath:AT4G18390

ath:AT5G08070

ath:AT5G60970

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.866

Rank 1 · LXL04_008711 · OH-1004

Cytoplasm0.137

Rank 2 · LXL04_008711 · OH-1004

Endoplasmic reticulum0.075

Rank 3 · LXL04_008711 · OH-1004

Cell membrane0.057

Rank 4 · LXL04_008711 · OH-1004

Plastid0.018

Rank 5 · LXL04_008711 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03634.20TCP86-148 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008711	`PF03634.20`	TCP	86	148	1.4e-25	91.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FME3`	Arabidopsis thaliana	Transcription factor TCP5	79.545%	Swiss-Prot	weak database homology
`Q9S7W5`	Arabidopsis thaliana	Transcription factor TCP13	69.231%	Swiss-Prot	weak database homology
`Q9LEZ9`	Arabidopsis thaliana	Transcription factor TCP17	77.381%	Swiss-Prot	weak database homology
`Q9C758`	Arabidopsis thaliana	Transcription factor TCP24	62.500%	Swiss-Prot	weak database homology
`Q93V43`	Arabidopsis thaliana	Transcription factor TCP2	65.278%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card