LXL04_008274 | RubberDandelionOmics

Gene overview

LXL04_008274

Reference: OH-1004 Chr: Chr02 Coordinates: 95325762-95329004 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1588 bp · LXL04_008274|LXL04_008274|OH1004|cDNA

ATGCGGGGGATCACCAACGGTGTTCATCTTCCGCCTATCATTGCTGAATTCGCCATTGATGGATGGTTGTCTACGAGTTCATCATCGGCCTCCTTCAAGTTGCTGGAGAAAACGATTCTAGGATTTCAAAGACTCGGACAACGCGGCGTCTATCTTCTTCGACCACAACGAGCTAGGGTTTCTTCTTTCTTTACCTCCTTCCAATCATCAAAATCGAACCCTAAATTCAAACCGATCTTCACTCACCCATTTCTTTCATC...

CDS

Download CDS FASTA

1575 bp · LXL04_008274|LXL04_008274|OH1004|CDS

ATGCGGGGGATCACCAACGGTGTTCATCTTCCGCCTATCATTGCTGAATTCGCCATTGATGGATGGTTGTCTACGAGTTCATCATCGGCCTCCTTCAAGTTGCTGGAGAAAACGATTCTAGGATTTCAAAGACTCGGACAACGCGGCGTCTATCTTCTTCGACCACAACGAGCTAGGGTTTCTTCTTTCTTTACCTCCTTCCAATCATCAAAATCGAACCCTAAATTCAAACCGATCTTCACTCACCCATTTCTTTCATC...

Protein

Download Protein FASTA

524 aa · LXL04_008274|LXL04_008274|OH1004|PROTEIN

MRGITNGVHLPPIIAEFAIDGWLSTSSSSASFKLLEKTILGFQRLGQRGVYLLRPQRARVSSFFTSFQSSKSNPKFKPIFTHPFLSSPLQKNRRKIVIFLLLPQQQMDGSHPFVNGDDEQLQFDNLNQNHEDYDDNVDDSGGGNEIRHSINDSSRDSSAGKLFVGGIAWETSEESFSNYFSHYGELTDSVIMMDKISGRPRGFGFVTFADPADADKVLEQDHVIDGRPVEVKRTVPREDMQGGRGLSRTKKIFVGGIPLT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008274`
TK1151 ID	TkA03G388850
OH-1004 ID	LXL04_008274
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.700
Protein coverage (%)	TK1151 80.332 / OH-1004 64.695 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008274

Location Chr02:95325762-95329004 (-)

Description Similar to RNP1: Heterogeneous nuclear ribonucleoprotein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g14300`	Involved with pre-mRNA processing.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008274 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006397 mRNA processing Biological Process

GO:0006417 regulation of translation Biological Process

GO:0008380 RNA splicing Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0048864 stem cell development Biological Process

GO:0051028 mRNA transport Biological Process

GO:1901000 regulation of response to salt stress Biological Process

GO:2000070 regulation of response to water deprivation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005681 spliceosomal complex Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT4G14300

cel:CELE_R10E9.1

dme:Dmel_CG32169

hsa:124540

mmu:76626

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.356

Rank 1 · LXL04_008274 · OH-1004

Cytoplasm0.341

Rank 2 · LXL04_008274 · OH-1004

Plastid0.278

Rank 3 · LXL04_008274 · OH-1004

Mitochondrion0.075

Rank 4 · LXL04_008274 · OH-1004

Endoplasmic reticulum0.069

Rank 5 · LXL04_008274 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00076.29RRM_1162-228 aa

PF23085.2RRM_PARP14_3165-232 aa

PF16367.12RRM_7250-312 aa

PF00076.29RRM_1252-321 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008274	`PF00076.29`	RRM_1	162	228	6.9e-32	109.9
LXL04_008274	`PF23085.2`	RRM_PARP14_3	165	232	2e-08	34.9
LXL04_008274	`PF16367.12`	RRM_7	250	312	3.1e-11	43.8
LXL04_008274	`PF00076.29`	RRM_1	252	321	6.9e-32	109.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W034`	Arabidopsis thaliana	Heterogeneous nuclear ribonucleoprotein 1	51.579%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card