LXL04_007709 | RubberDandelionOmics

Gene overview

LXL04_007709

Reference: OH-1004 Chr: Chr02 Coordinates: 57465879-57472094 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4395 bp · LXL04_007709|LXL04_007709|OH1004|cDNA

ATGGAACAGCGACGACGAAGCGGTGTGGTTGGCGAGGGGATGGCGAGTCTTCAGCGAAGCTTTGGCGAGGGGGATGGCGAGGCCACTCCCCCCGGCCTTACCAGCCGCCCAACAGAGGTAAACGAAAACCAATTCGCACACAAAAACTCAAAAAGTCACGCTGCGAACAGCCGTCGGTCGTCCACAGAGCGCTGCCTCCGGATGGAATTCCCTTCgttcaaccaccaccaccaccaccaccaccatcatcaGAACAGGTA...

CDS

Download CDS FASTA

4395 bp · LXL04_007709|LXL04_007709|OH1004|CDS

ATGGAACAGCGACGACGAAGCGGTGTGGTTGGCGAGGGGATGGCGAGTCTTCAGCGAAGCTTTGGCGAGGGGGATGGCGAGGCCACTCCCCCCGGCCTTACCAGCCGCCCAACAGAGGTAAACGAAAACCAATTCGCACACAAAAACTCAAAAAGTCACGCTGCGAACAGCCGTCGGTCGTCCACAGAGCGCTGCCTCCGGATGGAATTCCCTTCGTTCAACCACCACCACCACCACCACCACCATCATCAGAACAGGTA...

Protein

Download Protein FASTA

1464 aa · LXL04_007709|LXL04_007709|OH1004|PROTEIN

MEQRRRSGVVGEGMASLQRSFGEGDGEATPPGLTSRPTEVNENQFAHKNSKSHAANSRRSSTERCLRMEFPSFNHHHHHHHHHQNRYVPPPPPTNFSDERPNLYPHHQHLLPSLHLPPPPPLAYPSLPPPPPPPLPVPPPPPSYNPHQSNFTFLDAQSPSFFNNGRSSPPQPRLSNQSQRFVYRTDSWSDSHRVPTELSHRNPILPDDHHRRLYSPDSRSENHYKPHVSERGIPSSRYRDEAVVNGYASRDASNIVSQEQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007709`
TK1151 ID	TkAUNG001500
OH-1004 ID	LXL04_007709
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	96.600
Protein coverage (%)	TK1151 100.000 / OH-1004 95.423 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007709

Location Chr02:57465879-57472094 (+)

Description Similar to At1g21570: Zinc finger CCCH domain-containing protein 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g21570`	Possesses RNA-binding and ribonuclease activities in vitro.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007709 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006397 mRNA processing Biological Process

GO:0006401 RNA catabolic process Biological Process

GO:0010793 regulation of mRNA export from nucleus Biological Process

GO:0031124 mRNA 3'-end processing Biological Process

GO:0033621 nuclear mRNA surveillance of meiosis-specific transcripts Biological Process

GO:0051028 mRNA transport Biological Process

GO:0051168 nuclear export Biological Process

GO:0071030 nuclear mRNA surveillance of spliceosomal pre-mRNA splicing Biological Process

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005847 mRNA cleavage and polyadenylation specificity factor complex Cellular Component

KEGG gene cross-reference

dme:Dmel_CG6694

hsa:23144

mmu:223642

spo:2540291

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.955

Rank 1 · LXL04_007709 · OH-1004

Cytoplasm0.088

Rank 2 · LXL04_007709 · OH-1004

Cell membrane0.035

Rank 3 · LXL04_007709 · OH-1004

Endoplasmic reticulum0.020

Rank 4 · LXL04_007709 · OH-1004

Plastid0.014

Rank 5 · LXL04_007709 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28644.1C3H7_N1132-1237 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007709	`PF28644.1`	C3H7_N	1132	1237	1e-43	148.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3ED78`	Arabidopsis thaliana	Zinc finger CCCH domain-containing protein 7	53.728%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card