LXL04_007308 | RubberDandelionOmics

Gene overview

LXL04_007308

Reference: OH-1004 Chr: Chr02 Coordinates: 43557356-43559774 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1086 bp · LXL04_007308|LXL04_007308|OH1004|cDNA

ATGGAAACAAGCAAATCTTTGTCACATCCTAATATGGTTGTGATTCAAGGTGTTGTGAAAGAGCACAAAACGCCAATTATCGATGACCATTCAAGAGCCTTGTACTGCTGCTTACTGCCACCACTTCACCCTTTTAGTACAACGCTTGATAGAGACCTCTTATGTCTTATGACAAATGTCAAATTAGATTTAActttctctctctatctctatctctctcactctctctctctctctctctctctctctctctctctctc...

CDS

Download CDS FASTA

1086 bp · LXL04_007308|LXL04_007308|OH1004|CDS

ATGGAAACAAGCAAATCTTTGTCACATCCTAATATGGTTGTGATTCAAGGTGTTGTGAAAGAGCACAAAACGCCAATTATCGATGACCATTCAAGAGCCTTGTACTGCTGCTTACTGCCACCACTTCACCCTTTTAGTACAACGCTTGATAGAGACCTCTTATGTCTTATGACAAATGTCAAATTAGATTTAACTTTCTCTCTCTATCTCTATCTCTCTCACTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTC...

Protein

Download Protein FASTA

361 aa · LXL04_007308|LXL04_007308|OH1004|PROTEIN

METSKSLSHPNMVVIQGVVKEHKTPIIDDHSRALYCCLLPPLHPFSTTLDRDLLCLMTNVKLDLTFSLYLYLSHSLSLSLSLSLSLSLSHFPQMLSDGGGCGGDDVNKNLNTSHHNLGRVSTRSTTLSSSSSSNTSSNHSPFSVSLTVNQIKSTPTATRTMEEVWKDINLCSTTNHPAAGTKGYRGFILQDFLAKPFSNNETPTSLSSPGYGSPSPPPPAPPTSQPSMLINLNSGPDQLNFLADDPTRNVSPLDGPFDHV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007308`
TK1151 ID	TkA03G151330
OH-1004 ID	LXL04_007308
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 74.238 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007308

Location Chr02:43557356-43559774 (-)

Description Similar to FD: Protein FD

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g35900`	Transcription factor required for the transition to flowering promoted by FT.	No verified direct reference in this release
`At2g17770`	Transcription factor required for the transition to flowering promoted by FT.	No verified direct reference in this release
`At3g56850`	Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter.	No verified direct reference in this release
`At1g45249`	Involved in ABA and stress responses and acts as a positive component of glucose signal transduction.	Arabidopsis basic leucine zipper transcription factors involved in an abscisic acid-dependent signal transduction pathway under drought and high-salinity conditions.2000 · DOI: 10.1073/pnas.190309197 AREB1 is a transcription activator of novel ABRE-dependent ABA signaling that enhances drought stress tolerance in Arabidopsis.2005 · DOI: 10.1105/tpc.105.035659 Transcriptional regulation of ABI3- and ABA-responsive genes including RD29B and RD29A in seeds, germinating embryos, and seedlings of Arabidopsis.2006 · DOI: 10.1007/s11103-005-2418-5

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0766700`	Transcriptional activator that mediates abscisic acid (ABA) signaling.	Characterization of OsbZIP23 as a key player of the basic leucine zipper transcription factor family for conferring abscisic acid sensitivity and salinity and drought tolerance in rice.2008 · DOI: 10.1104/pp.108.128199 Feedback Regulation of ABA Signaling and Biosynthesis by a bZIP Transcription Factor Targets Drought-Resistance-Related Genes.2016 · DOI: 10.1104/pp.16.00469 OsREM4.1 Interacts with OsSERK1 to Coordinate the Interlinking between Abscisic Acid and Brassinosteroid Signaling in Rice.2016 · DOI: 10.1016/j.devcel.2016.06.011

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007308 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009648 photoperiodism Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0009911 positive regulation of flower development Biological Process

GO:0010255 glucose mediated signaling pathway Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:2000028 regulation of photoperiodism, flowering Biological Process

KEGG gene cross-reference

ath:AT1G45249

ath:AT2G17770

ath:AT3G56850

ath:AT4G35900

dosa:Os02g0766700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.935

Rank 1 · LXL04_007308 · OH-1004

Cytoplasm0.132

Rank 2 · LXL04_007308 · OH-1004

Cell membrane0.040

Rank 3 · LXL04_007308 · OH-1004

Endoplasmic reticulum0.029

Rank 4 · LXL04_007308 · OH-1004

Plastid0.013

Rank 5 · LXL04_007308 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07716.21bZIP_2291-340 aa

PF00170.27bZIP_1292-340 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007308	`PF07716.21`	bZIP_2	291	340	3.3e-11	43.8
LXL04_007308	`PF00170.27`	bZIP_1	292	340	3.2e-13	50.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84JK2`	Arabidopsis thaliana	Protein FD	40.984%	Swiss-Prot	moderate database homology
`Q7PCC6`	Arabidopsis thaliana	bZIP transcription factor 27	42.009%	Swiss-Prot	moderate database homology
`Q9LES3`	Arabidopsis thaliana	ABSCISIC ACID-INSENSITIVE 5-like protein 2	53.409%	Swiss-Prot	weak database homology
`Q9M7Q4`	Arabidopsis thaliana	ABSCISIC ACID-INSENSITIVE 5-like protein 5	53.750%	Swiss-Prot	weak database homology
`Q6Z312`	Oryza sativa subsp. japonica	bZIP transcription factor 23	48.039%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card