LXL04_007183 | RubberDandelionOmics

Gene overview

LXL04_007183

Reference: OH-1004 Chr: Chr02 Coordinates: 38326211-38330490 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2193 bp · LXL04_007183|LXL04_007183|OH1004|cDNA

ATGGAGAGCCCGGTCCCATATAGCAGAGGGTTGCAGAAACATTCGATCATGAAGCAGGCGCGAAGTGGATATGAACCATCTGATACCGAGACCGAATTACATGAAGCTCCTTGGATTCAATTCAACAAGAAAAATTTACAATTAGGATCTGGAGTACCAAAGATGAGTCCCGATGAAACTAGAAATTTGAACTCTCTGAGACTCAGCAGGAGACACTCTTCAAAGTTCGATCCCGAAGGTCTACCACCTCCGAGAAGACA...

CDS

Download CDS FASTA

2193 bp · LXL04_007183|LXL04_007183|OH1004|CDS

ATGGAGAGCCCGGTCCCATATAGCAGAGGGTTGCAGAAACATTCGATCATGAAGCAGGCGCGAAGTGGATATGAACCATCTGATACCGAGACCGAATTACATGAAGCTCCTTGGATTCAATTCAACAAGAAAAATTTACAATTAGGATCTGGAGTACCAAAGATGAGTCCCGATGAAACTAGAAATTTGAACTCTCTGAGACTCAGCAGGAGACACTCTTCAAAGTTCGATCCCGAAGGTCTACCACCTCCGAGAAGACA...

Protein

Download Protein FASTA

730 aa · LXL04_007183|LXL04_007183|OH1004|PROTEIN

MESPVPYSRGLQKHSIMKQARSGYEPSDTETELHEAPWIQFNKKNLQLGSGVPKMSPDETRNLNSLRLSRRHSSKFDPEGLPPPRRHSKSPYKARRDDGNPRSPTLGPLPLPPGRNISPFSKSERRRHVSPFVPSKRDDPLDNDEVNKQKHRLSNNESYQSYARTLSAPRLRSRDNNQQIKHDQRVKRREERSRTPPLRRSITPRKDKDLNSKHTPSVGEINEMVANAKLAKSPVRRGLVFDSTDSLPGGDIFFSRDYVP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007183`
TK1151 ID	TkA03G130890
OH-1004 ID	LXL04_007183
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007183

Location Chr02:38326211-38330490 (+)

Description Similar to RFC3: Replication factor C subunit 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g27740`	May be involved in DNA replication and thus regulate cell proliferation.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0792600`	May be involved in DNA replication and thus regulate cell proliferation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007183 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000076 DNA replication checkpoint signaling Biological Process

GO:0000731 DNA synthesis involved in DNA repair Biological Process

GO:0006260 DNA replication Biological Process

GO:0006261 DNA-templated DNA replication Biological Process

GO:0006271 DNA strand elongation involved in DNA replication Biological Process

GO:0006272 leading strand elongation Biological Process

GO:0006281 DNA repair Biological Process

GO:1900264 positive regulation of DNA-directed DNA polymerase activity Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005663 DNA replication factor C complex Cellular Component

GO:0031389 Rad17 RFC-like complex Cellular Component

KEGG gene cross-reference

ath:AT5G27740

ddi:DDB_G0293702

dosa:Os03g0792600

hsa:5983

mmu:69263

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.606

Rank 1 · LXL04_007183 · OH-1004

Nucleus0.329

Rank 2 · LXL04_007183 · OH-1004

Cell membrane0.088

Rank 3 · LXL04_007183 · OH-1004

Mitochondrion0.042

Rank 4 · LXL04_007183 · OH-1004

Lysosome / Vacuole0.038

Rank 5 · LXL04_007183 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21960.3RCF1-5-like_lid575-614 aa

PF22534.3RFC_C630-724 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007183	`PF21960.3`	RCF1-5-like_lid	575	614	2.2e-10	41.0
LXL04_007183	`PF22534.3`	RFC_C	630	724	2.6e-12	47.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VXX4`	Arabidopsis thaliana	Replication factor C subunit 3	37.921%	Swiss-Prot	weak database homology
`Q852K3`	Oryza sativa subsp. japonica	Replication factor C subunit 5	36.236%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card