LXL04_007137 | RubberDandelionOmics

Gene overview

LXL04_007137

Reference: OH-1004 Chr: Chr02 Coordinates: 37097375-37099067 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1401 bp · LXL04_007137|LXL04_007137|OH1004|cDNA

GGAGAAGGAGTAGTTCCTAGTTCCTACTCCTAATCGTGAACAGCAGTACAGCACACACAACACAGTAGAAACAATATGAAGTGCCCGTACTGTGCGGCGGCGCAAGGGCGGTGCGTCACCACATCTGCTGGTAGGTTTATCACGGAGTGCATATCCTGCGGCCGAGTCGTGGAAGAACGGCAAACGCAATCCCATCACCTCTTCCACATACGTGCTCAAGACTCTCCTCTCTGCCTAGTTACCTCCGACCTCCCCACACT...

CDS

Download CDS FASTA

1326 bp · LXL04_007137|LXL04_007137|OH1004|CDS

ATGAAGTGCCCGTACTGTGCGGCGGCGCAAGGGCGGTGCGTCACCACATCTGCTGGTAGGTTTATCACGGAGTGCATATCCTGCGGCCGAGTCGTGGAAGAACGGCAAACGCAATCCCATCACCTCTTCCACATACGTGCTCAAGACTCTCCTCTCTGCCTAGTTACCTCCGACCTCCCCACACTCCCCCACTCTATCATCGACCGATCCACCACCACCACCGCCGTGCCCATCTCCGAAGAAGAAGAAGACCCCTTCGA...

Protein

Download Protein FASTA

441 aa · LXL04_007137|LXL04_007137|OH1004|PROTEIN

MKCPYCAAAQGRCVTTSAGRFITECISCGRVVEERQTQSHHLFHIRAQDSPLCLVTSDLPTLPHSIIDRSTTTTAVPISEEEEDPFEPTGFITAFSTWSLEPYPVFAQSSLSFAGHLAELERVLETTSSSSASGPSVVVDNLRAYLQIIDVASILGLDCDISDHAFQLFRDCSSATCLRNRSVEALATAALVQAIREAQEPRTLQEISIAANLPQKEIGKYIKILGEALQLSQPLNSNSISVHMPRFCTLLQLNKSAQEL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007137`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007137

Location Chr02:37097375-37099067 (+)

Description Similar to PBRP1: Plant-specific TFIIB-related protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g36650`	Plant-specific TFIIB-related protein that may be involved in an intracellular signaling pathway between plastids and the nucleus.	Transcription factor IIB (TFIIB)-related protein (pBrp), a plant-specific member of the TFIIB-related protein family.2003 · DOI: 10.1128/mcb.23.9.3274-3286.2003 The plant-specific TFIIB-related protein, pBrp, is a general transcription factor for RNA polymerase I.2008 · DOI: 10.1038/emboj.2008.151

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007137 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001174 transcriptional start site selection at RNA polymerase II promoter Biological Process

GO:0006352 DNA-templated transcription initiation Biological Process

GO:0006366 transcription by RNA polymerase II Biological Process

GO:0006367 transcription initiation at RNA polymerase II promoter Biological Process

GO:0006473 protein acetylation Biological Process

GO:0010467 gene expression Biological Process

GO:0019083 viral transcription Biological Process

GO:0051123 RNA polymerase II preinitiation complex assembly Biological Process

GO:0051177 meiotic sister chromatid cohesion Biological Process

GO:0051225 spindle assembly Biological Process

GO:0051276 chromosome organization Biological Process

GO:0070897 transcription preinitiation complex assembly Biological Process

KEGG gene cross-reference

ath:AT4G36650

ddi:DDB_G0290929

mmu:229906

rno:81673

xla:394390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.897

Rank 1 · LXL04_007137 · OH-1004

Cytoplasm0.143

Rank 2 · LXL04_007137 · OH-1004

Cell membrane0.029

Rank 3 · LXL04_007137 · OH-1004

Plastid0.024

Rank 4 · LXL04_007137 · OH-1004

Endoplasmic reticulum0.018

Rank 5 · LXL04_007137 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00382.25TFIIB144-225 aa

PF00382.25TFIIB242-323 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007137	`PF00382.25`	TFIIB	144	225	2.2e-27	95.6
LXL04_007137	`PF00382.25`	TFIIB	242	323	2.2e-27	95.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23215`	Arabidopsis thaliana	Plant-specific TFIIB-related protein 1	81.769%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card