LXL04_007077 | RubberDandelionOmics

Gene overview

LXL04_007077

Reference: OH-1004 Chr: Chr02 Coordinates: 35323331-35324543 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

738 bp · LXL04_007077|LXL04_007077|OH1004|cDNA

ATGTTGTATACCATATCAATCCCCAAACCTTGCTCATCTTATCCAAAACGCCCTTGGCACTCCCAAAACCCTTCAAAACTCAAAATTGGTGGGCTTCGGGTATCAGCCACATTGCCGGAACCCAATGGCGTTAAAGTAGAGTACACCCCATGGCTAATCGTCGGATTGGGGAATCCAGGCAACAAGTATCACGGAACCCGCCACAACGTCGGTTTTGAAATGATTGATCGCATCTCTCAAGAAGAACGGATTGTGATGAA...

CDS

Download CDS FASTA

738 bp · LXL04_007077|LXL04_007077|OH1004|CDS

ATGTTGTATACCATATCAATCCCCAAACCTTGCTCATCTTATCCAAAACGCCCTTGGCACTCCCAAAACCCTTCAAAACTCAAAATTGGTGGGCTTCGGGTATCAGCCACATTGCCGGAACCCAATGGCGTTAAAGTAGAGTACACCCCATGGCTAATCGTCGGATTGGGGAATCCAGGCAACAAGTATCACGGAACCCGCCACAACGTCGGTTTTGAAATGATTGATCGCATCTCTCAAGAAGAACGGATTGTGATGAA...

Protein

Download Protein FASTA

245 aa · LXL04_007077|LXL04_007077|OH1004|PROTEIN

MLYTISIPKPCSSYPKRPWHSQNPSKLKIGGLRVSATLPEPNGVKVEYTPWLIVGLGNPGNKYHGTRHNVGFEMIDRISQEERIVMNTIQSKALVGIGSIGEVPVLLAKPQGYMNFSGESVGPLAAYYQVPLRHILLVYDEMSLPNGVLRLQPKGGHGYHNGLKSVIEHLDGRREFPRFCIGIGDPPGTMDMKAFLLQKFSDLERKEIDAALAQGVDAVRSLVLNGFNDRITRFNLGQKYKYNKV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007077`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007077

Location Chr02:35323331-35324543 (+)

Description Similar to CRS2: Chloroplastic group IIB intron splicing facilitator CRS2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g16140`	Required for the splicing of group IIB introns in chloroplasts.	No verified direct reference in this release
`At5g38290`	Required for the splicing of group IIB introns in chloroplasts.	No verified direct reference in this release
`At5g19830`	The natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during protein synthesis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0132800`	Required for the splicing of group IIB introns in chloroplasts.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007077 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006397 mRNA processing Biological Process

GO:0008380 RNA splicing Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

GO:0000049 tRNA binding Molecular Function

GO:0004045 peptidyl-tRNA hydrolase activity Molecular Function

KEGG gene cross-reference

ath:AT5G16140

ath:AT5G19830

ath:AT5G38290

dosa:Os01g0132800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.972

Rank 1 · LXL04_007077 · OH-1004

Mitochondrion0.036

Rank 2 · LXL04_007077 · OH-1004

Cytoplasm0.026

Rank 3 · LXL04_007077 · OH-1004

Nucleus0.025

Rank 4 · LXL04_007077 · OH-1004

Peroxisome0.021

Rank 5 · LXL04_007077 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01195.27Pept_tRNA_hydro52-239 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007077	`PF01195.27`	Pept_tRNA_hydro	52	239	4.1e-64	216.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LF14`	Arabidopsis thaliana	Chloroplastic group IIB intron splicing facilitator CRS2-B, chloroplastic	68.067%	Swiss-Prot	strong database homology
`Q9FKN4`	Arabidopsis thaliana	Chloroplastic group IIB intron splicing facilitator CRS2-A, chloroplastic	67.073%	Swiss-Prot	strong database homology
`Q6NLS8`	Arabidopsis thaliana	Peptidyl-tRNA hydrolase, mitochondrial	59.391%	Swiss-Prot	strong database homology
`Q5ZCL8`	Oryza sativa subsp. japonica	Chloroplastic group IIB intron splicing facilitator CRS2, chloroplastic	71.963%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card