LXL04_007034 | RubberDandelionOmics

Gene overview

LXL04_007034

Reference: OH-1004 Chr: Chr02 Coordinates: 34175506-34178088 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1164 bp · LXL04_007034|LXL04_007034|OH1004|cDNA

ATGGCGTATCAATCCAGCGAAAAAGATATCACAGATGATTTCGATATGCAAAGGATCGGGAACTTTCTCAGTTGTGCTTCGAGAGGTGATAGGGTTGGGCTTAATATGATGTTGAGGGACGGCATTTCTCCTAATGTGCAGGATTACGATAACAGGACTGCTCTTCATCTAGCTGCTAGTGAAGGTCATGCTTCGATTGTAGAGCTTCTTTTGCACTACAAGGCCGATGTTAATCTCGATGATAGATGGCATAGAACTCC...

CDS

Download CDS FASTA

1164 bp · LXL04_007034|LXL04_007034|OH1004|CDS

ATGGCGTATCAATCCAGCGAAAAAGATATCACAGATGATTTCGATATGCAAAGGATCGGGAACTTTCTCAGTTGTGCTTCGAGAGGTGATAGGGTTGGGCTTAATATGATGTTGAGGGACGGCATTTCTCCTAATGTGCAGGATTACGATAACAGGACTGCTCTTCATCTAGCTGCTAGTGAAGGTCATGCTTCGATTGTAGAGCTTCTTTTGCACTACAAGGCCGATGTTAATCTCGATGATAGATGGCATAGAACTCC...

Protein

Download Protein FASTA

387 aa · LXL04_007034|LXL04_007034|OH1004|PROTEIN

MAYQSSEKDITDDFDMQRIGNFLSCASRGDRVGLNMMLRDGISPNVQDYDNRTALHLAASEGHASIVELLLHYKADVNLDDRWHRTPLTDARLYGHRDICRILEVNGGKDSIMNSPMTVRHEEDAKEVNIEISEINSEHSEKIEQGVFGNSEKVKWRGTWVVKTKIKRQINFPVKMVLSANDNTRLRELRHPNILQFLGSIMHDGQMILITEHLSRGSLDDILKKRIGLDLQLALRFALDIARGMNYLHHHTPCPIIHNH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007034`
TK1151 ID	TkA03G105100
OH-1004 ID	LXL04_007034
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007034

Location Chr02:34175506-34178088 (-)

Description Similar to ILK1: Integrin-linked protein kinase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g18950`	Serine/threonine protein kinase that phosphorylates proteins on serine and threonine residues (By similarity).	No verified direct reference in this release
`At2g43850`	Functions as a link between plant defense pathways, stress responses and potassium homeostasis.	No verified direct reference in this release
`At1g14000`	Serine/threonine protein kinase which may function as an adapter protein for BRL2.	No verified direct reference in this release
`At5g03730`	Acts as a negative regulator in the ethylene response pathway.	CTR1 phosphorylates the central regulator EIN2 to control ethylene hormone signaling from the ER membrane to the nucleus in Arabidopsis.2012 · DOI: 10.1073/pnas.1214848109 Unsaturation of very-long-chain ceramides protects plant from hypoxia-induced damages by modulating ethylene signaling in Arabidopsis.2015 · DOI: 10.1371/journal.pgen.1005143 CTR1, a negative regulator of the ethylene response pathway in Arabidopsis, encodes a member of the raf family of protein kinases.1993 · DOI: 10.1016/0092-8674(93)90119-b

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007034 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001666 response to hypoxia Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0007229 integrin-mediated signaling pathway Biological Process

GO:0009637 response to blue light Biological Process

GO:0009686 gibberellin biosynthetic process Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009750 response to fructose Biological Process

KEGG gene cross-reference

ath:AT1G14000

ath:AT2G43850

ath:AT4G18950

ath:AT5G03730

ddi:DDB_G0271682

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.632

Rank 1 · LXL04_007034 · OH-1004

Nucleus0.293

Rank 2 · LXL04_007034 · OH-1004

Cell membrane0.188

Rank 3 · LXL04_007034 · OH-1004

Mitochondrion0.070

Rank 4 · LXL04_007034 · OH-1004

Golgi apparatus0.061

Rank 5 · LXL04_007034 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12796.14Ank_225-103 aa

PF13857.13Ank_538-88 aa

PF13637.13Ank_440-71 aa

PF00023.37Ank50-81 aa

PF13606.13Ank_350-78 aa

PF07714.24PK_Tyr_Ser-Thr140-373 aa

PF00069.32Pkinase140-356 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007034	`PF12796.14`	Ank_2	25	103	1.5e-12	48.6
LXL04_007034	`PF13857.13`	Ank_5	38	88	1.1e-08	35.9
LXL04_007034	`PF13637.13`	Ank_4	40	71	3.3e-07	31.2
LXL04_007034	`PF00023.37`	Ank	50	81	9.3e-13	48.4
LXL04_007034	`PF13606.13`	Ank_3	50	78	1.5e-06	28.7
LXL04_007034	`PF07714.24`	PK_Tyr_Ser-Thr	140	373	2.8e-23	83.3
LXL04_007034	`PF00069.32`	Pkinase	140	356	4e-18	66.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93Z30`	Arabidopsis thaliana	Serine/threonine-protein kinase 12	33.504%	Swiss-Prot	moderate database homology
`F4IS56`	Arabidopsis thaliana	Integrin-linked protein kinase 1	34.177%	Swiss-Prot	moderate database homology
`Q9XI87`	Arabidopsis thaliana	Serine/threonine-protein kinase VIK	31.486%	Swiss-Prot	moderate database homology
`Q05609`	Arabidopsis thaliana	Serine/threonine-protein kinase CTR1	29.965%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card