LXL04_006988 | RubberDandelionOmics

Gene overview

LXL04_006988

Reference: OH-1004 Chr: Chr02 Coordinates: 32931058-32931504 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

447 bp · LXL04_006988|LXL04_006988|OH1004|cDNA

ATGGCCAAAAGTTGTGCTGCTGTTGATACCACCGACGTTGAGAAAATTTTCAAGAAGTTTGACGTTAATGGCGACGGTAAGATATCCACTTCCGAACTCGGATCCATTCTCAGTGCACTCGGAACCGTCACGCCGGAGGAAGAACTTAAAGTCGTAATGAAGGAAATTGATACCGACGGCGACGGTTTCATTGACCTTAATGAATTCATCGAGTTTCAGCGCGGGGGATCTGGCGCTTCTGATGGAGATAAGGATCTGCG...

CDS

Download CDS FASTA

447 bp · LXL04_006988|LXL04_006988|OH1004|CDS

ATGGCCAAAAGTTGTGCTGCTGTTGATACCACCGACGTTGAGAAAATTTTCAAGAAGTTTGACGTTAATGGCGACGGTAAGATATCCACTTCCGAACTCGGATCCATTCTCAGTGCACTCGGAACCGTCACGCCGGAGGAAGAACTTAAAGTCGTAATGAAGGAAATTGATACCGACGGCGACGGTTTCATTGACCTTAATGAATTCATCGAGTTTCAGCGCGGGGGATCTGGCGCTTCTGATGGAGATAAGGATCTGCG...

Protein

Download Protein FASTA

148 aa · LXL04_006988|LXL04_006988|OH1004|PROTEIN

MAKSCAAVDTTDVEKIFKKFDVNGDGKISTSELGSILSALGTVTPEEELKVVMKEIDTDGDGFIDLNEFIEFQRGGSGASDGDKDLREAFDLYDQNKNGKISAAELHSVLKSLGEKCSLKDCRKMIASVDIDGDGSVNFEEFKKMMSK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006988`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006988

Location Chr02:32931058-32931504 (-)

Description Similar to CML26: Probable calcium-binding protein CML26

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g73630`	Potential calcium sensor.	No verified direct reference in this release
`At1g66400`	Potential calcium sensor.	No verified direct reference in this release
`At1g18210`	Potential calcium sensor.	No verified direct reference in this release
`At1g24620`	Potential calcium sensor.	No verified direct reference in this release
`At5g37770`	Calcium-binding protein that may positively regulate abscisic acid (ABA) inhibition of germination and seedling development.	CML24, regulated in expression by diverse stimuli, encodes a potential Ca2+ sensor that functions in responses to abscisic acid, daylength, and ion stress.2005 · DOI: 10.1104/pp.105.062612

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006988 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009909 regulation of flower development Biological Process

GO:0048767 root hair elongation Biological Process

GO:0071731 response to nitric oxide Biological Process

GO:0080164 regulation of nitric oxide metabolic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005509 calcium ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G18210

ath:AT1G24620

ath:AT1G66400

ath:AT1G73630

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.608

Rank 1 · LXL04_006988 · OH-1004

Nucleus0.271

Rank 2 · LXL04_006988 · OH-1004

Endoplasmic reticulum0.104

Rank 3 · LXL04_006988 · OH-1004

Peroxisome0.075

Rank 4 · LXL04_006988 · OH-1004

Mitochondrion0.073

Rank 5 · LXL04_006988 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00036.39EF-hand_112-39 aa

PF13499.13EF-hand_712-72 aa

PF13405.13EF-hand_613-41 aa

PF13202.13EF-hand_514-36 aa

PF21008.4AIF-114-75 aa

PF14658.13EF-hand_915-70 aa

PF13833.13EF-hand_825-72 aa

PF00036.39EF-hand_148-72 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006988	`PF00036.39`	EF-hand_1	12	39	1.8e-35	118.6
LXL04_006988	`PF13499.13`	EF-hand_7	12	72	3.4e-35	120.9
LXL04_006988	`PF13405.13`	EF-hand_6	13	41	1.5e-30	102.6
LXL04_006988	`PF13202.13`	EF-hand_5	14	36	8.4e-27	92.1
LXL04_006988	`PF21008.4`	AIF-1	14	75	1.7e-09	38.7
LXL04_006988	`PF14658.13`	EF-hand_9	15	70	1.7e-12	48.3
LXL04_006988	`PF13833.13`	EF-hand_8	25	72	9.8e-23	80.4
LXL04_006988	`PF00036.39`	EF-hand_1	48	72	1.8e-35	118.6
LXL04_006988	`PF13405.13`	EF-hand_6	48	72	1.5e-30	102.6
LXL04_006988	`PF13202.13`	EF-hand_5	52	72	8.4e-27	92.1
LXL04_006988	`PF13499.13`	EF-hand_7	84	147	3.4e-35	120.9
LXL04_006988	`PF00036.39`	EF-hand_1	85	113	1.8e-35	118.6
LXL04_006988	`PF13405.13`	EF-hand_6	85	114	1.5e-30	102.6
LXL04_006988	`PF13202.13`	EF-hand_5	86	109	8.4e-27	92.1
LXL04_006988	`PF14658.13`	EF-hand_9	89	147	1.7e-12	48.3
LXL04_006988	`PF13833.13`	EF-hand_8	98	146	9.8e-23	80.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9U8`	Arabidopsis thaliana	Probable calcium-binding protein CML26	56.944%	Swiss-Prot	strong database homology
`Q9C8Y1`	Arabidopsis thaliana	Probable calcium-binding protein CML23	56.204%	Swiss-Prot	strong database homology
`Q9LE22`	Arabidopsis thaliana	Probable calcium-binding protein CML27	54.054%	Swiss-Prot	strong database homology
`Q9FYK2`	Arabidopsis thaliana	Probable calcium-binding protein CML25	53.571%	Swiss-Prot	strong database homology
`P25070`	Arabidopsis thaliana	Calcium-binding protein CML24	53.642%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card