LXL04_006952 | RubberDandelionOmics

Gene overview

LXL04_006952

Reference: OH-1004 Chr: Chr02 Coordinates: 31920631-31925955 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2871 bp · LXL04_006952|LXL04_006952|OH1004|cDNA

ATGAATTATGACACTAACCGCACTCGTCATGAGACCGTGATCAATATAGTGAAGCCCACAGGGTTCACCGGCGGGTTAGAGTTTGTGAACCTGACCTACACCGTGACCAAGAAAAAGAAGACCGATGATGGCAAATGGGTTAACCAGGACACCGACTTGTTGAACCGGATCACAGGATTCGCACCCAAAGGGTGCGTGACCGCGGTCATGGGTCCAAGTGGTGCGGGGAAGTCTACTTTTTTGGATGGGTTAGCTGGCCG...

CDS

Download CDS FASTA

2871 bp · LXL04_006952|LXL04_006952|OH1004|CDS

ATGAATTATGACACTAACCGCACTCGTCATGAGACCGTGATCAATATAGTGAAGCCCACAGGGTTCACCGGCGGGTTAGAGTTTGTGAACCTGACCTACACCGTGACCAAGAAAAAGAAGACCGATGATGGCAAATGGGTTAACCAGGACACCGACTTGTTGAACCGGATCACAGGATTCGCACCCAAAGGGTGCGTGACCGCGGTCATGGGTCCAAGTGGTGCGGGGAAGTCTACTTTTTTGGATGGGTTAGCTGGCCG...

Protein

Download Protein FASTA

956 aa · LXL04_006952|LXL04_006952|OH1004|PROTEIN

MNYDTNRTRHETVINIVKPTGFTGGLEFVNLTYTVTKKKKTDDGKWVNQDTDLLNRITGFAPKGCVTAVMGPSGAGKSTFLDGLAGRIASGSLKGKVLLDGAEMSPSLIKRTSAYIMQDDRLFSMLTVYETLMFAADFRLGSIPKAEKRRRVEMLIEQLGLSSARNTYIGDEGTRGVSGGERRRVSIGVDIIHGPSLLFLDEPTSGLDSTSAQSVIEKVHNIAQTGSTVVLTIHQPSSRILLLLDHLIILARGQLMYQGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006952`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006952

Location Chr02:31920631-31925955 (+)

Description Similar to STR2: ABC transporter G family member STR2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g55130`	Confers selective resistance to kanamycin.	Overexpression of an Arabidopsis thaliana ABC transporter confers kanamycin resistance to transgenic plants.2005 · DOI: 10.1038/nbt1134
`At3g55110`	ABC transporter G family member 18.	No verified direct reference in this release
`At3g53510`	ABC transporter G family member 20.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006952 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007034 vacuolar transport Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:0010345 suberin biosynthetic process Biological Process

GO:0036377 arbuscular mycorrhizal association Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005775 vacuolar lumen Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0085042 periarbuscular membrane Cellular Component

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT3G53510

ath:AT3G55110

ath:AT3G55130

mtr:11407838

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.620

Rank 1 · LXL04_006952 · OH-1004

Endoplasmic reticulum0.125

Rank 2 · LXL04_006952 · OH-1004

Cytoplasm0.102

Rank 3 · LXL04_006952 · OH-1004

Lysosome / Vacuole0.088

Rank 4 · LXL04_006952 · OH-1004

Golgi apparatus0.068

Rank 5 · LXL04_006952 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13481.13AAA_2550-134 aa

PF00005.34ABC_tran56-205 aa

PF19055.7ABC2_membrane_7234-290 aa

PF01061.30ABC2_membrane448-654 aa

PF00076.29RRM_1810-875 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006952	`PF13481.13`	AAA_25	50	134	8.8e-06	26.2
LXL04_006952	`PF00005.34`	ABC_tran	56	205	1.5e-24	87.9
LXL04_006952	`PF19055.7`	ABC2_membrane_7	234	290	2.4e-06	27.4
LXL04_006952	`PF01061.30`	ABC2_membrane	448	654	4e-39	135.1
LXL04_006952	`PF00076.29`	RRM_1	810	875	8e-12	45.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M3D6`	Arabidopsis thaliana	ABC transporter G family member 19	40.030%	Swiss-Prot	moderate database homology
`Q9M2V5`	Arabidopsis thaliana	ABC transporter G family member 18	39.072%	Swiss-Prot	moderate database homology
`Q9LFG8`	Arabidopsis thaliana	ABC transporter G family member 20	39.628%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card