RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_006533
Reference: OH-1004 Chr: Chr02 Coordinates: 13049102-13057594 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3468 bp · LXL04_006533|LXL04_006533|OH1004|cDNA

ATGTCGGAAACAATTGAAGAAGAGAATTTACTCGCGGCTGCTAATCTTATCCTCACGGCACTTGATTCCAACAAGAAAATCACCAATGGAACAAAAAAAGTCTTGGTGGATTTGGGCATCCGATTGACTTCCATGGCCAAAGCTACTGTACACGAAGatggagatgatgaagaagatgaagataaAGAACTTAGCGATATTAAATCACAGATCAATTCGATTCAAGAAAAGATCATGAATTGGGAAGGAGACGAATCCAT...

CDS

Download CDS FASTA

3468 bp · LXL04_006533|LXL04_006533|OH1004|CDS

ATGTCGGAAACAATTGAAGAAGAGAATTTACTCGCGGCTGCTAATCTTATCCTCACGGCACTTGATTCCAACAAGAAAATCACCAATGGAACAAAAAAAGTCTTGGTGGATTTGGGCATCCGATTGACTTCCATGGCCAAAGCTACTGTACACGAAGATGGAGATGATGAAGAAGATGAAGATAAAGAACTTAGCGATATTAAATCACAGATCAATTCGATTCAAGAAAAGATCATGAATTGGGAAGGAGACGAATCCAT...

Protein

Download Protein FASTA

1155 aa · LXL04_006533|LXL04_006533|OH1004|PROTEIN

MSETIEEENLLAAANLILTALDSNKKITNGTKKVLVDLGIRLTSMAKATVHEDGDDEEDEDKELSDIKSQINSIQEKIMNWEGDESMIWDSDPEEAKEYLKTVDEARRLSESLENLKLGKDDNTLLRNINAILQTSMARMEEEFRHILVHNRQNFEPEHFSFRSNEDDGFDENSVLSFGDDSIDDSVQRDSVSRGSEVFVMDLINPTVIPDLKGIANSMFDSNYGRECTHAFISVRKDALDDCLFILEIEKLSIEDVVKM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_006533
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_006533
LocationChr02:13049102-13057594 (+)
DescriptionSimilar to WDR12: Ribosome biogenesis protein WDR12 homolog
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g15550 Required for maturation of ribosomal RNAs and formation of the large ribosomal subunit. No verified direct reference in this release
At5g61010 Influences the subcellular localization patterns of other exocyst complex proteins (e.g. SEC5A, SEC15A, SEC15B and EXO84B) leading to their recruitment to exocyst, well-defined large punctate structures throughout the cytosol.
EXPO, an exocyst-positive organelle distinct from multivesicular endosomes and autophagosomes, mediates cytosol to cell wall exocytosis in Arabidopsis and tobacco cells.2010 · DOI: 10.1105/tpc.110.080697
Exo70E2 is essential for exocyst subunit recruitment and EXPO formation in both plants and animals.2014 · DOI: 10.1091/mbc.e13-10-0586
At5g58430 Component of an exocyst subcomplex specifically involved in autophagy-related, Golgi-independent membrane traffic to the vacuole.
Arabidopsis exocyst subcomplex containing subunit EXO70B1 is involved in autophagy-related transport to the vacuole.2013 · DOI: 10.1111/tra.12101
The N-Terminal UND Motif of the Arabidopsis U-Box E3 Ligase PUB18 Is Critical for the Negative Regulation of ABA-Mediated Stomatal Movement and Determines Its Ubiquitination Specificity for Exocyst Subunit Exo70B1.2016 · DOI: 10.1105/tpc.16.00347
At1g07000 Component of an exocyst subcomplex specifically involved in autophagy-related, Golgi-independent membrane traffic to the vacuole.
The role for the exocyst complex subunits Exo70B2 and Exo70H1 in the plant-pathogen interaction.2011 · DOI: 10.1093/jxb/erq402
The ubiquitin ligase PUB22 targets a subunit of the exocyst complex required for PAMP-triggered responses in Arabidopsis.2012 · DOI: 10.1105/tpc.112.104463
The N-Terminal UND Motif of the Arabidopsis U-Box E3 Ligase PUB18 Is Critical for the Negative Regulation of ABA-Mediated Stomatal Movement and Determines Its Ubiquitination Specificity for Exocyst Subunit Exo70B1.2016 · DOI: 10.1105/tpc.16.00347

Rice

Reference gene IDPossible functionPapers / DOI
Os07g0600400 Required for maturation of ribosomal RNAs and formation of the large ribosomal subunit. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_006533 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process
GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process
GO:0002237 response to molecule of bacterial origin Biological Process
GO:0002238 response to molecule of fungal origin Biological Process
GO:0006887 exocytosis Biological Process
GO:0006952 defense response Biological Process
GO:0006955 immune response Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0009617 response to bacterium Biological Process
GO:0009620 response to fungus Biological Process
GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process
GO:0015031 protein transport Biological Process
KEGG gene cross-reference
ath:AT1G07000
ath:AT5G15550
ath:AT5G58430
ath:AT5G61010
dosa:Os07g0600400
osa:4343819
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.538
Rank 1 · LXL04_006533 · OH-1004
Nucleus0.313
Rank 2 · LXL04_006533 · OH-1004
Cell membrane0.215
Rank 3 · LXL04_006533 · OH-1004
Lysosome / Vacuole0.089
Rank 4 · LXL04_006533 · OH-1004
Golgi apparatus0.083
Rank 5 · LXL04_006533 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20669.4Exo70_N71-149 aa
PF03081.23Exo70_C271-644 aa
PF08154.19NLE731-798 aa
PF25047.1Beta-prop_TEP1_2nd828-903 aa
PF24807.2WD40_CDC20-Fz830-959 aa
PF25173.2Beta-prop_WDR3_1st831-907 aa
PF25175.2Beta-prop_WDR5833-958 aa
PF23414.2Beta-prop_EML_2836-965 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_006533PF20669.4Exo70_N711498.9e-1452.2
LXL04_006533PF03081.23Exo70_C2716443.3e-120402.3
LXL04_006533PF08154.19NLE7317981.4e-1971.0
LXL04_006533PF25047.1Beta-prop_TEP1_2nd8289035e-2072.4
LXL04_006533PF24807.2WD40_CDC20-Fz8309591.4e-1971.2
LXL04_006533PF25173.2Beta-prop_WDR3_1st8319077.1e-30104.8
LXL04_006533PF25175.2Beta-prop_WDR58339581.3e-33117.3
LXL04_006533PF23414.2Beta-prop_EML_28369654e-1350.1
LXL04_006533PF24814.2WD40_Prp198379711.2e-2694.2
LXL04_006533PF25174.2Beta-prop_THOC38399094.4e-32111.9
LXL04_006533PF23381.2Beta-prop_IFT122_1st8399654.7e-2795.8
LXL04_006533PF25172.2Beta-prop_WDR3_2nd8399552.7e-1453.8
LXL04_006533PF25391.2WD40_Gbeta8419548.7e-1142.1
LXL04_006533PF00400.39WD408589021.1e-32111.7
LXL04_006533PF24782.3WD40_MABP1-WDR62_2nd86211061.7e-0628.0
LXL04_006533PF24105.2Beta-prop_CAF1B_HIR187010617.4e-1555.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LF27Arabidopsis thalianaRibosome biogenesis protein WDR12 homolog68.281%Swiss-Protweak database homology
Q9FNR3Arabidopsis thalianaExocyst complex component EXO70E237.500%Swiss-Protmoderate database homology
Q9FGH9Arabidopsis thalianaExocyst complex component EXO70B131.259%Swiss-Protmoderate database homology
Q9LMJ4Arabidopsis thalianaExocyst complex component EXO70B229.008%Swiss-Protweak database homology
Q8H594Oryza sativa subsp. japonicaRibosome biogenesis protein WDR12 homolog63.504%Swiss-Protweak database homology

JBrowse

View in Genome Browser