LXL04_006134 | RubberDandelionOmics

Gene overview

LXL04_006134

Reference: OH-1004 Chr: Chr02 Coordinates: 2096792-2102639 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1803 bp · LXL04_006134|LXL04_006134|OH1004|cDNA

ATGGTACTTTTTCATGGTGAGGTGGATGATATTGATGACATTGATTGGGATACAGAAGATGAACTTGAAATACAGAACATAGGATCATCTTCTTGTTCAACTTTAGTAACTAGCAATACTCAAACTGCTATTATCAGCAATGGGGagGCAAGCTCATCAGCAAGCTCCTCAAACTCCAAGTTGCTACAGCATTTCCTAGGAATGGGGTTCTCTGACAAATTGATTATAAAAGCAATCGAAGAAAATGGGGAAGATAACCC...

CDS

Download CDS FASTA

1803 bp · LXL04_006134|LXL04_006134|OH1004|CDS

ATGGTACTTTTTCATGGTGAGGTGGATGATATTGATGACATTGATTGGGATACAGAAGATGAACTTGAAATACAGAACATAGGATCATCTTCTTGTTCAACTTTAGTAACTAGCAATACTCAAACTGCTATTATCAGCAATGGGGAGGCAAGCTCATCAGCAAGCTCCTCAAACTCCAAGTTGCTACAGCATTTCCTAGGAATGGGGTTCTCTGACAAATTGATTATAAAAGCAATCGAAGAAAATGGGGAAGATAACCC...

Protein

Download Protein FASTA

600 aa · LXL04_006134|LXL04_006134|OH1004|PROTEIN

MVLFHGEVDDIDDIDWDTEDELEIQNIGSSSCSTLVTSNTQTAIISNGEASSSASSSNSKLLQHFLGMGFSDKLIIKAIEENGEDNPESILETLLTYSALEEPQDGNFSCHTNSHQQQQENVNYDDFSSDYDETIPNELSEFDSLSDDEIPENYESLPKHEKTLLSLTKMGYSVEEASAAVERCPDAPIGDLTDFIDVARLAKTEAEFFEEEKPKPLFTLNPKLKRKKLLETYKTKKQKGQLTEEDDLIRLPNPMIGFGV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006134`
TK1151 ID	TkA03G010630
OH-1004 ID	LXL04_006134
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006134

Location Chr02:2096792-2102639 (-)

Description Similar to DRM2: DNA (cytosine-5)-methyltransferase DRM2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q9M548`	Involved in de novo DNA methylation.	No verified direct reference in this release
`UniProt: Q9LXE5`	Involved in de novo DNA methylation.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0110800`	Involved in de novo DNA methylation.	No verified direct reference in this release
`Os05g0133900`	Involved in de novo DNA methylation.	No verified direct reference in this release
`Os12g0108900`	Involved in de novo DNA methylation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006134 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006346 DNA methylation-dependent constitutive heterochromatin formation Biological Process

GO:0032259 methylation Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003886 DNA (cytosine-5-)-methyltransferase activity Molecular Function

GO:0008168 methyltransferase activity Molecular Function

GO:0009008 DNA-methyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT5G14620

ath:AT5G15380

dosa:Os03g0110800

dosa:Os05g0133900

dosa:Os12g0108900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.769

Rank 1 · LXL04_006134 · OH-1004

Cytoplasm0.254

Rank 2 · LXL04_006134 · OH-1004

Mitochondrion0.043

Rank 3 · LXL04_006134 · OH-1004

Cell membrane0.039

Rank 4 · LXL04_006134 · OH-1004

Endoplasmic reticulum0.026

Rank 5 · LXL04_006134 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00145.24DNA_methylase476-590 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006134	`PF00145.24`	DNA_methylase	476	590	9.7e-12	45.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M548`	Arabidopsis thaliana	DNA (cytosine-5)-methyltransferase DRM2	53.913%	Swiss-Prot	strong database homology
`Q9LXE5`	Arabidopsis thaliana	DNA (cytosine-5)-methyltransferase DRM1	49.687%	Swiss-Prot	moderate database homology
`Q10SU5`	Oryza sativa subsp. japonica	DNA (cytosine-5)-methyltransferase DRM2	49.836%	Swiss-Prot	moderate database homology
`Q6AUQ7`	Oryza sativa subsp. japonica	Probable inactive DNA (cytosine-5)-methyltransferase DRM3	33.387%	Swiss-Prot	moderate database homology
`Q2QYR5`	Oryza sativa subsp. japonica	Probable inactive DNA (cytosine-5)-methyltransferase DRM1B	42.605%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card