LXL04_005714 | RubberDandelionOmics

Gene overview

LXL04_005714

Reference: OH-1004 Chr: Chr01 Coordinates: 171786393-171789929 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2118 bp · LXL04_005714|LXL04_005714|OH1004|cDNA

ATGGCTGATGATTATCAAATGGCGCTTCATCGTATGCAAACTCAGACTTCTATatttgttgatgatttttcgCTCAAAGACTATGTCCTCACAGAAATTGAAAGATTATTAAATTCCTCAATTCCCTCTAAATCCTTGAGCGACTTTCACCTTCCACTACCGTCCAACATAAAAGGTCGATTCATCCAAAATCGACTTCTTTTAGAAGAGAAATCCTATGACCGAACTACATTGCATAATGAACATGCAATGATGGTTAC...

CDS

Download CDS FASTA

2118 bp · LXL04_005714|LXL04_005714|OH1004|CDS

ATGGCTGATGATTATCAAATGGCGCTTCATCGTATGCAAACTCAGACTTCTATATTTGTTGATGATTTTTCGCTCAAAGACTATGTCCTCACAGAAATTGAAAGATTATTAAATTCCTCAATTCCCTCTAAATCCTTGAGCGACTTTCACCTTCCACTACCGTCCAACATAAAAGGTCGATTCATCCAAAATCGACTTCTTTTAGAAGAGAAATCCTATGACCGAACTACATTGCATAATGAACATGCAATGATGGTTAC...

Protein

Download Protein FASTA

705 aa · LXL04_005714|LXL04_005714|OH1004|PROTEIN

MADDYQMALHRMQTQTSIFVDDFSLKDYVLTEIERLLNSSIPSKSLSDFHLPLPSNIKGRFIQNRLLLEEKSYDRTTLHNEHAMMVTQLNPDQLTIYEKVRSAITSNQQILLFVYGHGGTGKTFLWSTIIAFFRSIGKIVLVVAGSGIASLLLPSGRTAHSRFNIPLHVSNSSMCNIKKGTHLAALLQETSIIIWDEATMTDRRCFECVDRSLRDILDRKDIPFGGISVLLGGDFRQTLPVKPKKSMAEIISATLPNSTL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005714`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005714

Location Chr01:171786393-171789929 (+)

Description Similar to PIF4: ATP-dependent DNA helicase PIF4 (Trypanosoma brucei brucei (strain 927/4 GUTat10.1)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g45400`	Component of the replication protein A complex (RPA) required for DNA recombination, repair and replication.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005714 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000723 telomere maintenance Biological Process

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0006260 DNA replication Biological Process

GO:0006281 DNA repair Biological Process

GO:0006289 nucleotide-excision repair Biological Process

GO:0006310 DNA recombination Biological Process

GO:0007004 telomere maintenance via telomerase Biological Process

GO:0007140 male meiotic nuclear division Biological Process

GO:0051276 chromosome organization Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0071932 replication fork reversal Biological Process

GO:0097046 replication fork progression beyond termination site Biological Process

KEGG gene cross-reference

ath:AT5G45400

prw:PsycPRwf_1560

sce:YHR031C

tbr:Tb11.01.6420

tbr:Tb11.02.4730

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.820

Rank 1 · LXL04_005714 · OH-1004

Cytoplasm0.258

Rank 2 · LXL04_005714 · OH-1004

Mitochondrion0.034

Rank 3 · LXL04_005714 · OH-1004

Extracellular0.021

Rank 4 · LXL04_005714 · OH-1004

Cell membrane0.020

Rank 5 · LXL04_005714 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05970.21PIF188-297 aa

PF13604.13AAA_3089-258 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005714	`PF05970.21`	PIF1	88	297	4.6e-76	256.0
LXL04_005714	`PF13604.13`	AAA_30	89	258	5.3e-07	30.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FHJ6`	Arabidopsis thaliana	Replication protein A 70 kDa DNA-binding subunit C	25.253%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card