Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3015 bp · LXL04_005392|LXL04_005392|OH1004|cDNA
ATGGCCCTCTTCAACCACCATAGTTATGATATCGAGAGTCAAGAATTGGGAAATTTTGGGAAATTGCCTCGGTTAAGGCATGAAGATGATCCAGGAAATAAGTTATCCAAGGAAACCCATCGACTTCCTTTTTCAATAGATTACCATCAACAACCACCTAAATCTTTCCATAACTTGGATGATTTGTTTCTTGACACCTCCCATCCATTTCGATCATACCAACATCAAATGCAAGAGCTTGCGAATATCGAATCCCAATA...
3015 bp · LXL04_005392|LXL04_005392|OH1004|CDS
ATGGCCCTCTTCAACCACCATAGTTATGATATCGAGAGTCAAGAATTGGGAAATTTTGGGAAATTGCCTCGGTTAAGGCATGAAGATGATCCAGGAAATAAGTTATCCAAGGAAACCCATCGACTTCCTTTTTCAATAGATTACCATCAACAACCACCTAAATCTTTCCATAACTTGGATGATTTGTTTCTTGACACCTCCCATCCATTTCGATCATACCAACATCAAATGCAAGAGCTTGCGAATATCGAATCCCAATA...
Protein
Download Protein FASTA1004 aa · LXL04_005392|LXL04_005392|OH1004|PROTEIN
MALFNHHSYDIESQELGNFGKLPRLRHEDDPGNKLSKETHRLPFSIDYHQQPPKSFHNLDDLFLDTSHPFRSYQHQMQELANIESQYSELIKPHTNHDVVRHEVKSRKLSTDQVIRLGGEKFIQSCSSSSINNISMPSHPYRSSFLSFSNQEAKDVELVQNLLLSAEKVSQKQFERAIKLLNWCDLLSSNSGNPIQRLVYYFSKALRDKIGNETGRILIHGPGKKHLDDMEGRLLTPNPTSISVYQKLPFFQAGEFSGVQ...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_005392 |
|---|---|
| TK1151 ID | TkA01G056160 |
| OH-1004 ID | LXL04_005392 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 79.600 |
| Protein coverage (%) | TK1151 95.290 / OH-1004 45.618Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_005392 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:162562881-162575365 (+) | |||||||||
| Description | Similar to DELLA1: DELLA protein 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0009610 response to symbiotic fungus Biological Process GO:0009737 response to abscisic acid Biological Process GO:0009739 response to gibberellin Biological Process GO:0009740 gibberellic acid mediated signaling pathway Biological Process GO:0009938 negative regulation of gibberellic acid mediated signaling pathway Biological Process GO:0010187 negative regulation of seed germination Biological Process GO:0010431 seed maturation Biological Process GO:0016036 cellular response to phosphate starvation Biological Process GO:0036377 arbuscular mycorrhizal association Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT5G17490 mtr:25489240 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03514.21GRAS158-452 aaPF03514.21GRAS665-782 aaPF03514.21GRAS784-957 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_005392 | PF03514.21 | GRAS | 158 | 452 | 1.1e-110 | 370.9 |
| LXL04_005392 | PF03514.21 | GRAS | 665 | 782 | 1.1e-110 | 370.9 |
| LXL04_005392 | PF03514.21 | GRAS | 784 | 957 | 1.1e-110 | 370.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.