LXL04_004943 | RubberDandelionOmics

Gene overview

LXL04_004943

Reference: OH-1004 Chr: Chr01 Coordinates: 150664319-150668220 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2367 bp · LXL04_004943|LXL04_004943|OH1004|cDNA

ATGACGATGATGAGCGCCTGGAAGCAAATCTCTAGTAATGGAGGCCAAACCGAACAAATTTTGGCGCAATATTTCCCTCAAATCGACCACAAACACGGCGATTggaagaagaagctgcaactGACATCGACCCTTTTCGAACAATTTTTCTCCACTGCTGACGGATTAGAACTCATCTCTCAGGTAAAAAAGGAAGACATATTGTTCATTCTACCCCTTGATTTCCAACATTTCCGGAAAGTATGTATGCTTGAAGAATT...

CDS

Download CDS FASTA

2367 bp · LXL04_004943|LXL04_004943|OH1004|CDS

ATGACGATGATGAGCGCCTGGAAGCAAATCTCTAGTAATGGAGGCCAAACCGAACAAATTTTGGCGCAATATTTCCCTCAAATCGACCACAAACACGGCGATTGGAAGAAGAAGCTGCAACTGACATCGACCCTTTTCGAACAATTTTTCTCCACTGCTGACGGATTAGAACTCATCTCTCAGGTAAAAAAGGAAGACATATTGTTCATTCTACCCCTTGATTTCCAACATTTCCGGAAAGTATGTATGCTTGAAGAATT...

Protein

Download Protein FASTA

788 aa · LXL04_004943|LXL04_004943|OH1004|PROTEIN

MTMMSAWKQISSNGGQTEQILAQYFPQIDHKHGDWKKKLQLTSTLFEQFFSTADGLELISQVKKEDILFILPLDFQHFRKVCMLEEFYDAFERNPKEALLCMSAAVHKVLYSKSNDEELDDSTKVNIRLHNHPDSMIALKNLKAAYIERLVSVRGTVVKVSTVKPLVVQMSFTCAKCGTTIARDFPDGKFSPPSVCVIQGCKSRSFNPIRSTAIPIDFQKIRIQELLKSEHHEEGRVPRTVECELVEDLVDTCIPGDVVT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004943`
TK1151 ID	TkA01G094980
OH-1004 ID	LXL04_004943
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004943

Location Chr01:150664319-150668220 (-)

Description Similar to MCM8: Probable DNA helicase MCM8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g09660`	Probable DNA helicase that plays a role in meiotic double-strand break (DSB) repair, but does not seem to be required for recombination with the homologous chromosome.	MCM8 is required for a pathway of meiotic double-strand break repair independent of DMC1 in Arabidopsis thaliana.2013 · DOI: 10.1371/journal.pgen.1003165

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0464100`	Probable DNA helicase that may play a role in DNA repair during meiosis.	No verified direct reference in this release
`UniProt: B8AZ14`	Probable DNA helicase that may play a role in DNA repair during meiosis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004943 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0006260 DNA replication Biological Process

GO:0006974 DNA damage response Biological Process

GO:0007140 male meiotic nuclear division Biological Process

GO:0007143 female meiotic nuclear division Biological Process

GO:0007292 female gamete generation Biological Process

GO:0009555 pollen development Biological Process

GO:0036298 recombinational interstrand cross-link repair Biological Process

GO:0048232 male gamete generation Biological Process

GO:0050821 protein stabilization Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0071168 protein localization to chromatin Biological Process

KEGG gene cross-reference

ath:AT3G09660

dosa:Os05g0464100

mmu:66634

rno:296178

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.854

Rank 1 · LXL04_004943 · OH-1004

Cytoplasm0.159

Rank 2 · LXL04_004943 · OH-1004

Mitochondrion0.070

Rank 3 · LXL04_004943 · OH-1004

Cell membrane0.021

Rank 4 · LXL04_004943 · OH-1004

Golgi apparatus0.010

Rank 5 · LXL04_004943 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17207.10MCM_OB139-268 aa

PF00493.30MCM340-554 aa

PF07728.21AAA_5390-527 aa

PF07726.18AAA_3390-505 aa

PF01078.28Mg_chelatase439-510 aa

PF17855.8MCM_lid607-690 aa

PF25051.2WHD_MCM8702-777 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004943	`PF17207.10`	MCM_OB	139	268	2e-27	96.1
LXL04_004943	`PF00493.30`	MCM	340	554	1.8e-88	296.1
LXL04_004943	`PF07728.21`	AAA_5	390	527	5.4e-07	30.4
LXL04_004943	`PF07726.18`	AAA_3	390	505	5.1e-06	27.1
LXL04_004943	`PF01078.28`	Mg_chelatase	439	510	1.8e-07	31.5
LXL04_004943	`PF17855.8`	MCM_lid	607	690	8.7e-27	94.2
LXL04_004943	`PF25051.2`	WHD_MCM8	702	777	1.8e-24	86.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SF37`	Arabidopsis thaliana	Probable DNA helicase MCM8	69.804%	Swiss-Prot	strong database homology
`B9FKM7`	Oryza sativa subsp. japonica	Probable DNA helicase MCM8	64.729%	Swiss-Prot	strong database homology
`B8AZ14`	Oryza sativa subsp. indica	Probable DNA helicase MCM8	64.759%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card