LXL04_004833 | RubberDandelionOmics

Gene overview

LXL04_004833

Reference: OH-1004 Chr: Chr01 Coordinates: 148450077-148457548 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3834 bp · LXL04_004833|LXL04_004833|OH1004|cDNA

ATGGCCGATCCGGCGTACTCTGCCCTCAGAAAAATGCTACTGGACGAGATCACGCCGGTGGTCATGGTTCTCCCTACGCCACTAGTAGAAGAACGATGCCAAAAAAATGGACTCTCATTTGTCCAAATGCTCACTCCGTTTTGCGTATTCAACAATATTGATGTCCCTGTTCGTACAGCTAGTGACCAACCCTACAGGCTTCAAAAGTTCAAATTACGAATGGTTTATGCATCAGATGTTCGACAACCAAATGTTGAGGT...

CDS

Download CDS FASTA

3834 bp · LXL04_004833|LXL04_004833|OH1004|CDS

ATGGCCGATCCGGCGTACTCTGCCCTCAGAAAAATGCTACTGGACGAGATCACGCCGGTGGTCATGGTTCTCCCTACGCCACTAGTAGAAGAACGATGCCAAAAAAATGGACTCTCATTTGTCCAAATGCTCACTCCGTTTTGCGTATTCAACAATATTGATGTCCCTGTTCGTACAGCTAGTGACCAACCCTACAGGCTTCAAAAGTTCAAATTACGAATGGTTTATGCATCAGATGTTCGACAACCAAATGTTGAGGT...

Protein

Download Protein FASTA

1277 aa · LXL04_004833|LXL04_004833|OH1004|PROTEIN

MADPAYSALRKMLLDEITPVVMVLPTPLVEERCQKNGLSFVQMLTPFCVFNNIDVPVRTASDQPYRLQKFKLRMVYASDVRQPNVEVTKERLKQVITDAGNIEDSDLYLEPSSIETISTSSQPDFVPTWFQFFNKEFVRSVSFSDHEAFDHPVACLLVVSSNDKDPINKFVDLFNMNQLPPLLNEGAMDPKIPKVFVLLHDNQDGSSERASKILAEMRNTFGANDCRLLCINSLQDGAPAHEPNPWEFYMPNASPDQNLG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004833`
TK1151 ID	TkA01G102910
OH-1004 ID	LXL04_004833
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	88.100
Protein coverage (%)	TK1151 98.491 / OH-1004 81.832 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_004833`
Location	Chr01:148450077-148457548 (+)
Description	Similar to TRAPPC8: Trafficking protein particle complex subunit 8
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_004833` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006886 intracellular protein transport Biological Process GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process GO:0007030 Golgi organization Biological Process GO:0016192 vesicle-mediated transport Biological Process GO:0016236 macroautophagy Biological Process GO:0032964 collagen biosynthetic process Biological Process GO:0048208 COPII vesicle coating Biological Process GO:0051321 meiotic cell cycle Biological Process GO:0099022 vesicle tethering Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component
KEGG gene cross-reference	cel:CELE_F46F11.9 hsa:22878 spo:2539665 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.514

Rank 1 · LXL04_004833 · OH-1004

Golgi apparatus0.298

Rank 2 · LXL04_004833 · OH-1004

Nucleus0.187

Rank 3 · LXL04_004833 · OH-1004

Lysosome / Vacuole0.139

Rank 4 · LXL04_004833 · OH-1004

Endoplasmic reticulum0.126

Rank 5 · LXL04_004833 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12739.13TRAPPC-Trs8515-432 aa

PF24545.2Ig_TPPC8_1st606-749 aa

PF24544.2Ig_TPPC8_2nd801-920 aa

PF24542.2Ig_TPPC8_C1097-1215 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004833	`PF12739.13`	TRAPPC-Trs85	15	432	8.2e-87	293.0
LXL04_004833	`PF24545.2`	Ig_TPPC8_1st	606	749	8e-19	68.8
LXL04_004833	`PF24544.2`	Ig_TPPC8_2nd	801	920	2e-14	55.0
LXL04_004833	`PF24542.2`	Ig_TPPC8_C	1097	1215	6.5e-08	33.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card