Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1614 bp · LXL04_004727|LXL04_004727|OH1004|cDNA
ATGTGGAACTTCAGAAGAAAATTTGCGCGATCACTGTTACTGCTTTCACATCGCAATAATTTCAGTTCAAGAAGTAATCATACCGTCATTCACTCAACGCAAATTATCACTTACCATGTAAATCTGTCCAAACCCTCGACAAGTTTTTCGGTTAAACCCTCTGGCTTTCCAATATTTTTCTCTTCATCAGCTTCGAAACGTGAAGGGAATTCAGATTCCGATGAGCTCCGTGAAAACCAATTAGAAGATGACGGTGAGAG...
1614 bp · LXL04_004727|LXL04_004727|OH1004|CDS
ATGTGGAACTTCAGAAGAAAATTTGCGCGATCACTGTTACTGCTTTCACATCGCAATAATTTCAGTTCAAGAAGTAATCATACCGTCATTCACTCAACGCAAATTATCACTTACCATGTAAATCTGTCCAAACCCTCGACAAGTTTTTCGGTTAAACCCTCTGGCTTTCCAATATTTTTCTCTTCATCAGCTTCGAAACGTGAAGGGAATTCAGATTCCGATGAGCTCCGTGAAAACCAATTAGAAGATGACGGTGAGAG...
Protein
Download Protein FASTA537 aa · LXL04_004727|LXL04_004727|OH1004|PROTEIN
MWNFRRKFARSLLLLSHRNNFSSRSNHTVIHSTQIITYHVNLSKPSTSFSVKPSGFPIFFSSSASKREGNSDSDELRENQLEDDGERLILSEDFHEKTKLERETELLMEIIRRPDRSCVALRNNLEKCGVTASPELVTEVLSQVRNDWELAFTFFLWAGNQPDYSHSLRIYHSMIAILGKMRRFDTAWTLIDEMKRGGKNGGESMVTPQTLLIMIRRYSAAHDVGKAINAFYAHKQFKFEVTIDSFQDLLSALCRYKNVK...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_004727 |
|---|---|
| TK1151 ID | TkA01G118120 |
| OH-1004 ID | LXL04_004727 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 80.074Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_004727 | ||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:144757029-144758642 (+) | ||||||||||||||||||
| Description | Similar to At5g15010: Pentatricopeptide repeat-containing protein At5g15010, mitochondrial | ||||||||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | ||||||||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||||||||
| GO annotations (OH1004 source) | GO:0005739 mitochondrion Cellular Component GO:0022626 cytosolic ribosome Cellular Component GO:0003729 mRNA binding Molecular Function | ||||||||||||||||||
| KEGG gene cross-reference | ath:AT1G80880 ath:AT3G15200 ath:AT5G15010 ath:AT5G65820 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13041.13PPR_2277-321 aaPF13812.13PPR_3300-356 aaPF13041.13PPR_2311-347 aaPF17177.11PPR_long312-429 aaPF29070.1MSC6_N321-407 aaPF13812.13PPR_3334-390 aaPF12854.14PPR_1343-375 aaPF13041.13PPR_2346-395 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_004727 | PF13041.13 | PPR_2 | 277 | 321 | 6e-47 | 158.3 |
| LXL04_004727 | PF13812.13 | PPR_3 | 300 | 356 | 7e-29 | 100.4 |
| LXL04_004727 | PF13041.13 | PPR_2 | 311 | 347 | 6e-47 | 158.3 |
| LXL04_004727 | PF17177.11 | PPR_long | 312 | 429 | 1.2e-18 | 68.0 |
| LXL04_004727 | PF29070.1 | MSC6_N | 321 | 407 | 1e-20 | 74.9 |
| LXL04_004727 | PF13812.13 | PPR_3 | 334 | 390 | 7e-29 | 100.4 |
| LXL04_004727 | PF12854.14 | PPR_1 | 343 | 375 | 2e-35 | 120.9 |
| LXL04_004727 | PF13041.13 | PPR_2 | 346 | 395 | 6e-47 | 158.3 |
| LXL04_004727 | PF01535.27 | PPR | 350 | 379 | 1.2e-37 | 126.2 |
| LXL04_004727 | PF13812.13 | PPR_3 | 370 | 424 | 7e-29 | 100.4 |
| LXL04_004727 | PF12854.14 | PPR_1 | 378 | 409 | 2e-35 | 120.9 |
| LXL04_004727 | PF13041.13 | PPR_2 | 382 | 426 | 6e-47 | 158.3 |
| LXL04_004727 | PF01535.27 | PPR | 384 | 414 | 1.2e-37 | 126.2 |
| LXL04_004727 | PF29070.1 | MSC6_N | 424 | 507 | 1e-20 | 74.9 |
| LXL04_004727 | PF17177.11 | PPR_long | 429 | 522 | 1.2e-18 | 68.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q9LFQ4 | Arabidopsis thaliana | Pentatricopeptide repeat-containing protein At5g15010, mitochondrial | 54.286% | Swiss-Prot | strong database homology |
Q9SAH2 | Arabidopsis thaliana | Pentatricopeptide repeat-containing protein At1g80880, mitochondrial | 35.401% | Swiss-Prot | moderate database homology |
Q9LIL5 | Arabidopsis thaliana | Putative pentatricopeptide repeat-containing protein At3g15200 | 34.328% | Swiss-Prot | moderate database homology |
Q9FH87 | Arabidopsis thaliana | Putative pentatricopeptide repeat-containing protein At5g65820 | 29.440% | Swiss-Prot | weak database homology |
Q9M8M3 | Arabidopsis thaliana | Pentatricopeptide repeat-containing protein At1g80550, mitochondrial | 33.333% | Swiss-Prot | moderate database homology |