LXL04_004614 | RubberDandelionOmics

Gene overview

LXL04_004614

Reference: OH-1004 Chr: Chr01 Coordinates: 141522135-141526186 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1608 bp · LXL04_004614|LXL04_004614|OH1004|cDNA

ATGGGGGATAAAATCCACGTGGATACAAGACAACCACCCGAAACCTCCACAGTCGTCCTCCTCCCCGCCAACCACCCACCACCATTACCGGATTTCACAtacaaacacacacacacaagtTCGCATAGAATCAGATTCCCAAACATGATCAGCTTTACTAACGAAATTCAGGTTGCGAAAATGTCATTGAAATCTATAACTCCGAGCTCTTCCTCCTTACATTTCCCGCGTTTATCGGTGGTTAATTCACCGACATACAT...

CDS

Download CDS FASTA

1608 bp · LXL04_004614|LXL04_004614|OH1004|CDS

ATGGGGGATAAAATCCACGTGGATACAAGACAACCACCCGAAACCTCCACAGTCGTCCTCCTCCCCGCCAACCACCCACCACCATTACCGGATTTCACATACAAACACACACACACAAGTTCGCATAGAATCAGATTCCCAAACATGATCAGCTTTACTAACGAAATTCAGGTTGCGAAAATGTCATTGAAATCTATAACTCCGAGCTCTTCCTCCTTACATTTCCCGCGTTTATCGGTGGTTAATTCACCGACATACAT...

Protein

Download Protein FASTA

535 aa · LXL04_004614|LXL04_004614|OH1004|PROTEIN

MGDKIHVDTRQPPETSTVVLLPANHPPPLPDFTYKHTHTSSHRIRFPNMISFTNEIQVAKMSLKSITPSSSSLHFPRLSVVNSPTYILFTRCTLIRPTYPAISLRKSCYFLFPIPLEVLSTGRSNRSTKSTEDGRQETPTGNNDDDDSSDETYQSSDDLDKVTATDSKRSISSLSDALNIGSRDPVYEVVEVSSKGMVSTRKVNRRHLLKSSGEHSNNIMISFRLNSFLLTGLRPRDIRSVDPSLWLTNTMPSLLVRENA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004614`
TK1151 ID	TkA01G130620
OH-1004 ID	LXL04_004614
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004614

Location Chr01:141522135-141526186 (-)

Description Similar to MRS2-11: Magnesium transporter MRS2-11, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g22830`	High-affinity magnesium transporter that mediates the influx of magnesium in chloroplast.	A novel family of magnesium transport genes in Arabidopsis.2001 · DOI: 10.1105/tpc.010352

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0684400`	Magnesium transporter that may mediate the influx of magnesium in chloroplast.	No verified direct reference in this release
`UniProt: B8APK3`	Magnesium transporter that may mediate the influx of magnesium in chloroplast.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004614 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010027 thylakoid membrane organization Biological Process

GO:0010117 photoprotection Biological Process

GO:0010960 magnesium ion homeostasis Biological Process

GO:0015693 magnesium ion transport Biological Process

GO:0045016 mitochondrial magnesium ion transmembrane transport Biological Process

GO:1903830 magnesium ion transmembrane transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0031969 chloroplast membrane Cellular Component

KEGG gene cross-reference

ath:AT5G22830

dosa:Os03g0684400

spo:2540385

yli:2911169

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.929

Rank 1 · LXL04_004614 · OH-1004

Mitochondrion0.050

Rank 2 · LXL04_004614 · OH-1004

Nucleus0.044

Rank 3 · LXL04_004614 · OH-1004

Cytoplasm0.033

Rank 4 · LXL04_004614 · OH-1004

Cell membrane0.022

Rank 5 · LXL04_004614 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22099.2MRS2-like231-465 aa

PF01544.24CorA416-523 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004614	`PF22099.2`	MRS2-like	231	465	1.5e-30	106.9
LXL04_004614	`PF01544.24`	CorA	416	523	6.2e-07	29.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q058N4`	Arabidopsis thaliana	Magnesium transporter MRS2-11, chloroplastic	71.989%	Swiss-Prot	moderate database homology
`Q9AUK4`	Oryza sativa subsp. japonica	Magnesium transporter MRS2-A, chloroplastic	65.879%	Swiss-Prot	strong database homology
`B8APK3`	Oryza sativa subsp. indica	Magnesium transporter MRS2-A, chloroplastic	65.879%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card