LXL04_004241 | RubberDandelionOmics

Gene overview

LXL04_004241

Reference: OH-1004 Chr: Chr01 Coordinates: 130755879-130763146 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5511 bp · LXL04_004241|LXL04_004241|OH1004|cDNA

ATGTGGACAAATGTCTTCAAAATCGGTGGTCTACACCAAGTGTCATGGTTCCAGTTTCTCCCAAACGAATCTGATCCCAACATCTCTGATAGAAGTGGAAAACTAAATCAAAGAGATTTTGCTGCACAAATAGTGCTTTCATCCCATTTGCAATTACAAAAAGATGGGTTCCTTAGCACATGGGGTAATTCATTTGTTGGCCCATGGGATCCATCTCAGGGCCTACATAACCCTGACGAGAAAATCAAGCTGTGGCTTTT...

CDS

Download CDS FASTA

5511 bp · LXL04_004241|LXL04_004241|OH1004|CDS

ATGTGGACAAATGTCTTCAAAATCGGTGGTCTACACCAAGTGTCATGGTTCCAGTTTCTCCCAAACGAATCTGATCCCAACATCTCTGATAGAAGTGGAAAACTAAATCAAAGAGATTTTGCTGCACAAATAGTGCTTTCATCCCATTTGCAATTACAAAAAGATGGGTTCCTTAGCACATGGGGTAATTCATTTGTTGGCCCATGGGATCCATCTCAGGGCCTACATAACCCTGACGAGAAAATCAAGCTGTGGCTTTT...

Protein

Download Protein FASTA

1836 aa · LXL04_004241|LXL04_004241|OH1004|PROTEIN

MWTNVFKIGGLHQVSWFQFLPNESDPNISDRSGKLNQRDFAAQIVLSSHLQLQKDGFLSTWGNSFVGPWDPSQGLHNPDEKIKLWLFIPGRHSSPNDKAKSVVSKLRVLASGVWLAPGDSEEVAAALSQALRNCIERALVNLSYMRFGDVFSRYHPSSQGESFRRGRPVLEFIFTATEEAVFVHVIISAKHVRSLSNGDMEAILKRTSSHSKDRLPVIVSPHGMRGRLTGFCPGDLVKQLYFSSGKFKASNGIVGLPNQM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004241`
TK1151 ID	TkA01G180090
OH-1004 ID	LXL04_004241
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004241

Location Chr01:130755879-130763146 (-)

Description Similar to MED13: Mediator of RNA polymerase II transcription subunit 13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g55325`	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes.	The MED12-MED13 module of Mediator regulates the timing of embryo patterning in Arabidopsis.2010 · DOI: 10.1242/dev.043174 MACCHI-BOU 2 is required for early embryo patterning and cotyledon organogenesis in Arabidopsis.2011 · DOI: 10.1093/pcp/pcr013

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004241 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006367 transcription initiation at RNA polymerase II promoter Biological Process

GO:0006935 chemotaxis Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0040034 regulation of development, heterochronic Biological Process

GO:0042632 cholesterol homeostasis Biological Process

GO:0045165 cell fate commitment Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0048870 cell motility Biological Process

KEGG gene cross-reference

ath:AT1G55325

ddi:DDB_G0282375

dme:Dmel_CG9936

dre:564707

mmu:327987

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.745

Rank 1 · LXL04_004241 · OH-1004

Cytoplasm0.244

Rank 2 · LXL04_004241 · OH-1004

Mitochondrion0.055

Rank 3 · LXL04_004241 · OH-1004

Cell membrane0.040

Rank 4 · LXL04_004241 · OH-1004

Golgi apparatus0.029

Rank 5 · LXL04_004241 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11597.14Med13_N2-322 aa

PF18296.7MID_MedPIWI1068-1305 aa

PF06333.18Med13_C1420-1813 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004241	`PF11597.14`	Med13_N	2	322	2.9e-26	93.4
LXL04_004241	`PF18296.7`	MID_MedPIWI	1068	1305	2.1e-37	129.5
LXL04_004241	`PF06333.18`	Med13_C	1420	1813	1.1e-16	61.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I096`	Arabidopsis thaliana	Mediator of RNA polymerase II transcription subunit 13	51.217%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card