LXL04_003385 | RubberDandelionOmics

Gene overview

LXL04_003385

Reference: OH-1004 Chr: Chr01 Coordinates: 77105698-77112676 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3270 bp · LXL04_003385|LXL04_003385|OH1004|cDNA

ATGAACAAGGGTAACGGCCGGAAACGGCCGGCGCAGCAACCACCGGTGCCGGCACAACCACCCAAGCACCATGCGGCAGAGGCGCCCATGGAAGAGGAAGATATGGACGAGGATGTATTCATTGAAGAAAACCTCATCGACGAAGATGAACTCATCCTCCGGGATATGGAGGACAGGGAAGCTCTCGCAGCTCGTCTTGAGAAATGGAAGCGACCGGCATTATCTACAGGGTATCAGTCCCAGTCAGAGAACATAGtttt...

CDS

Download CDS FASTA

3270 bp · LXL04_003385|LXL04_003385|OH1004|CDS

ATGAACAAGGGTAACGGCCGGAAACGGCCGGCGCAGCAACCACCGGTGCCGGCACAACCACCCAAGCACCATGCGGCAGAGGCGCCCATGGAAGAGGAAGATATGGACGAGGATGTATTCATTGAAGAAAACCTCATCGACGAAGATGAACTCATCCTCCGGGATATGGAGGACAGGGAAGCTCTCGCAGCTCGTCTTGAGAAATGGAAGCGACCGGCATTATCTACAGGGTATCAGTCCCAGTCAGAGAACATAGTTTT...

Protein

Download Protein FASTA

1089 aa · LXL04_003385|LXL04_003385|OH1004|PROTEIN

MNKGNGRKRPAQQPPVPAQPPKHHAAEAPMEEEDMDEDVFIEENLIDEDELILRDMEDREALAARLEKWKRPALSTGYQSQSENIVFQQLEIDYVIGESHKGLIPNSSGPAAIIRIFGVTKEGNSVCCNVHGFEPYFYISCPPGMGPDDISRFHQILEGRMREVNRNNNVPKFIIRIELVQKKSIMYYQQHKSQPFLKIVVALPTMVASCRGILDKGIQIDGIGMKSFMTYESNVLFVLRYMIDCNIVGGNWIEVPAHKY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003385`
TK1151 ID	TkA01G321100
OH-1004 ID	LXL04_003385
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003385

Location Chr01:77105698-77112676 (+)

Description Similar to POLD1: DNA polymerase delta catalytic subunit

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g63960`	This polymerase possesses two enzymatic activities: DNA synthesis (polymerase) and an exonucleolytic activity that degrades single-stranded DNA in the 3'- to 5'-direction.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0186400`	This polymerase possesses two enzymatic activities: DNA synthesis (polymerase) and an exonucleolytic activity that degrades single-stranded DNA in the 3'- to 5'-direction.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003385 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000731 DNA synthesis involved in DNA repair Biological Process

GO:0006260 DNA replication Biological Process

GO:0006261 DNA-templated DNA replication Biological Process

GO:0006287 base-excision repair, gap-filling Biological Process

GO:0006297 nucleotide-excision repair, DNA gap filling Biological Process

GO:0034644 cellular response to UV Biological Process

GO:0045004 DNA replication proofreading Biological Process

GO:0055089 fatty acid homeostasis Biological Process

GO:0070987 error-free translesion synthesis Biological Process

GO:0071897 DNA biosynthetic process Biological Process

GO:0000109 nucleotide-excision repair complex Cellular Component

GO:0000781 chromosome, telomeric region Cellular Component

KEGG gene cross-reference

ath:AT5G63960

dosa:Os11g0186400

gmx:548092

mmu:18971

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.622

Rank 1 · LXL04_003385 · OH-1004

Cytoplasm0.366

Rank 2 · LXL04_003385 · OH-1004

Mitochondrion0.096

Rank 3 · LXL04_003385 · OH-1004

Cell membrane0.040

Rank 4 · LXL04_003385 · OH-1004

Endoplasmic reticulum0.032

Rank 5 · LXL04_003385 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24055.3POL3_N132-207 aa

PF03104.26DNA_pol_B_exo1230-463 aa

PF00136.27DNA_pol_B527-960 aa

PF14260.12zf-C4pol997-1068 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003385	`PF24055.3`	POL3_N	132	207	5.8e-07	30.6
LXL04_003385	`PF03104.26`	DNA_pol_B_exo1	230	463	1.7e-70	237.9
LXL04_003385	`PF00136.27`	DNA_pol_B	527	960	2.9e-161	538.0
LXL04_003385	`PF14260.12`	zf-C4pol	997	1068	3.8e-19	69.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LVN7`	Arabidopsis thaliana	DNA polymerase delta catalytic subunit	82.403%	Swiss-Prot	strong database homology
`Q9LRE6`	Oryza sativa subsp. japonica	DNA polymerase delta catalytic subunit	85.741%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card